Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G050810-GRMZM2G008273
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):LOC100283125

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MESLEALVAHIQGLSGSPEELAHLHSLLKQADGEPLRAHAAALVPFLAHLSPETHSLGYI
YLLDACAASASNLSDFGGGDFLVTIAGFLTACSADQIRLAPDKFLHVCKVLKDQVMQLNM
PIRGIAPLRAAVRKIQSSPEQLTPVHADYLLLCLLAKQYKAGLSVLEDDIFEVDQPKDLF
LYCYYGGMIYIGLKKFPKA

MESLEALVAHIQGLSGSPEELAHLHSLLKQADGEPLRAHAAALVPFLAHLSPETHSLGYL
YLLEACATSSSNLSDFGGGDFLVTIGGFLTACSADQIRLAPDKFLNVCRVLKDQVMQLNM
PIRGIAPLRAAVPKIQSSPEQLTPVHADYLILCLLAKQYKAGLSVLEGDIFEVDQPKDLF
LYCYYGGMIYVGLKKFPKALELLHNAVTAPMSSLNAIAVEAYKKYILVSLIVNGQVPPFP
KYTSISAQRSMRNHAQIYAELSTSYSNGSKTDLETFIQSNSAAFQSDNNLGLVKQVLSSM
YKRNIQRLTQTYLTLSLEDIARSVQLETPRDAEMHVLRMIEDGEIHASINQKDGMVSFHE
DPEQYKSVEMVEHIDTSIHRLTALSKKLASIDQNMSCDTAYLMTGRDRGRFDYDDFDSVP
HKYF*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):61GC content 2 (%):51GC content divergence:-0.089
Length 1 (bp):597Length 2 (bp):1275Length divergence:0.362
MFE 1 (kcal):-235.3MFE 2 (kcal):-427.02MFE divergence0.289