Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G050842-GRMZM2G474726
Species:maize
Duplication type:WGD
Function (paralog1):protein alx (LOC100284595), mRNA
Function (paralog2):

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-1.5045217032322
Log2 mRNA fold difference:1.1678349180537
Log2 TE fold difference:-2.7061264636383
Sequences
Protein sequence

MASAVAASTATRFLPRLPDPWWTRRARAALPPPPLTWRPLPFTVSAASSRPGEAEGGRRG
RMRRRRARRAEQEEGVSLSSEKETVNSTPRAQPKKGAEPVAVSSTSGKGSAIRRVTLVIL
AAVLFGVSIALKDGAEKASEYFAGYLLEQSLSVDNLFVFVLVFKYFKVPNEYQNRVLSYG
IAGAVVFRAVMIILGTATIQKFEAVNLLLALILLFTSYKLFAEEEEESDLSDNFIVKTCQ
KFIPVTDYYDDNRFFTNQDGVWKATPLLLTLAVIELSDIAFAIDSIPAVFGVTRDPLIIL
SSNIFAISGLRSLYVLVSESMGELEYLQPAIGIVLGFIGTKMIFDFFGYHIPTEASLAIV
TTCLSGGVILSLRKASKEKGDK*

MASAVGASTATRFLPRLPDPWRPRRARAALPPLTWRPPAVTVAAASPRPGEAEGRRRERT
RRRRARGPGQEEGVSLSSEKETLNSTPRAQTNKDAEPEPVSSTTGKGSAIRRVTLVVLAA
VLFGVSIALRDGAEKASEYFAGYLLEQSLSVDNLFVFVLVFKYFKVPKEYQNRILSYGIA
GAVVFRAVMIILGTASIQKFEAVNLLLAVILLFTSYKLFAEEEQESDLSDNFIVKTCQKF
IPVTEYYDDDRFFTNQDGLWKATPLLLTLAVIELSDIAFAIDSIPAVFGVTRDPLIILSS
NIFAISGLRPLYVLISESMSELEYLQPAIGIVLGFIGTKMIFDFFGYHIPTEASLAVVTT
CLSGGVILSLRKASKVEGDK*

Other information
Ka divergence:0.12126KaKs divergence:0.24815
GC content 1 (%):48GC content 2 (%):49GC content divergence:0.01
Length 1 (bp):1149Length 2 (bp):1143Length divergence:-0.003
MFE 1 (kcal):-412.5MFE 2 (kcal):-408.8MFE divergence-0.005