Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G050912-GRMZM2G134863
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100279469
Function (paralog2):hypothetical protein LOC100384730

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-1.977133843577
Log2 mRNA fold difference:-1.5157472723096
Log2 TE fold difference:-0.49008856822608
Sequences
Protein sequence

MTAADGESCAVVATAADIICSLRGADLAGWTPPWRKHEAACDGVREEEGGGGDEARDLAW
PAVARGKRSRSRRESPSASGSAASADAKKKKKARRGVRGSPASPLDYSGVSGSGASTSGG
EDGAFCFQPEPAFPPAAACQLAEPAVLPPPPPPPSEVGGLAGRRTILPVPPPRPAGQRAR
KKMRLPEIQQMVRSLSVENDALRKTMKELQRACTALSQENGKLETRLDQSTTLNEAVSVE
NKGKPQPQRQRAAEQEAPSGFVLPDLNLPADV*

MTAADGEACAVVATAADIICSLRGADLAGWTPPWSQRQHEPDPARDGVQAEGGDDARDLA
WPAVARGKRSRSRRESPSASGSAASAGATTTATKKKTARRGARGSPASPLDYSGASGSGS
GASTSGGEDGAFCSRPDPALPPAAACQQLAAPPPPSKVGGLAGRRTIPAVPVPLPPPRPA
GQRARKKMRLPEIQQMVRSLSVENDALRKEMRALQRDCTALSQENGKLETRLHQSITLSE
AISVENKGKPRPLQPEQEAPSGFVLPDLNLPADV*

Other information
Ka divergence:-0.191986KaKs divergence:-0.00725624
GC content 1 (%):72GC content 2 (%):72GC content divergence:0
Length 1 (bp):819Length 2 (bp):825Length divergence:0.004
MFE 1 (kcal):-428.2MFE 2 (kcal):-431.62MFE divergence0.004