Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G050925-GRMZM2G043737
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100276789
Function (paralog2):Putative uncharacterized protein

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MIIPKKNRNEICKYLFKEGVLYAKKDYNLAKHPQIDVPNLQVIKLMQSFKSKEYVRETFS
WQYYYWYLTNDGIEHLRNYLNLPSEIVPATLKKSARPLGRPFGSGPPGDRPRGPGRFEDR
PRFGDRDEYRGGPRGAPGDFGGDKSGAPAEFQPSFRSSGARPGFGRGGGSGFGAGPTSSM
E*

MIIPKKNRNEICKYLFKEGVLYAKKDYNLAKHPQIDVPNLQVIKLMQSFKSKEYVRETFS
WQYYYWYLTNDGIEHLRNYLNLPSEIVPATLKKSAKPPGRPFGSGPPGDRPRGPGRFDGD
RPRFGDRDGYRGGPRGAPGDFGGDKSGAPAEFQPSFRRPQMWTGKA

www.000webhost.com

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):57GC content 2 (%):55GC content divergence:-0.018
Length 1 (bp):546Length 2 (bp):498Length divergence:-0.046
MFE 1 (kcal):-213MFE 2 (kcal):-196.52MFE divergence-0.04