Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G050961-GRMZM2G103236
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100273606
Function (paralog2):

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-1.1411616303528
Log2 mRNA fold difference:-1.4148721947767
Log2 TE fold difference:0.2726038649096
Sequences
Protein sequence

MAPSLLAAMSTSPFLASSGSSRRPLGAAHTRRAGLRVAALKYDPAKVAPQNDRVLVRLEQ
IPEKSAGGVLLPKSAVKFERYLMGEILSIGAEVSEVEAGKKVLFSDINAYEVELGTDEEK
HCFCRESDLLAVVE*

MGEILSVGADVSEVEAGKKVLFSDINAYEVDLDTDEKHCFCRESDLLAVVE*

Other information
Ka divergence:-0.499369KaKs divergence:-0.740273
GC content 1 (%):56GC content 2 (%):46GC content divergence:-0.098
Length 1 (bp):405Length 2 (bp):156Length divergence:-0.444
MFE 1 (kcal):-145.6MFE 2 (kcal):-45.1MFE divergence-0.527