Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G050971-GRMZM2G113017
Species:maize
Duplication type:WGD
Function (paralog1):iron-sulfur assembly protein IscA
Function (paralog2):iron-sulfur assembly protein IscA (LOC100282850), mRNA

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-0.19505232329572
Log2 mRNA fold difference:0.29727304822348
Log2 TE fold difference:-0.48899291626063
Sequences
Protein sequence

MALASGTCRPLLGGPASTARLHLAVSSSSTACSIRFPRGAGGGRAAVSLRAPAPPAAAAA
TSGSIAPAISLTEKALKHLNKMRAERNEDLCLRIGVKQGGCSGMSYTMEFENRADASPDD
SVVEYDGFAIVCDPKSLLFMFGMELDYSNALIGGGFSFQNPNATKTCGCGKSFATGKESE
AAAKACNN*

MALASATSRPLLGRPRRHRAAPPRRFLILPRLLDPLPPRRRRRRQQSGRLSPRPHASRLS
AFNLSLNDRAAATATSGSIAPAISLTEKALKHLNQMRAERNEVLCLRIGVKQGGCSGMSY
TMEFENRENASPDDSVVEYDGFAIVCDPKSLLFMFGMELDYSDALIGGGFLFQNPNATKT
CGCGKSFATGKETEAAATTCNN*

Other information
Ka divergence:0.43446KaKs divergence:-0.260565
GC content 1 (%):57GC content 2 (%):56GC content divergence:-0.009
Length 1 (bp):567Length 2 (bp):609Length divergence:0.036
MFE 1 (kcal):-208MFE 2 (kcal):-197.7MFE divergence-0.025