Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G051043-GRMZM2G069816
Species:maize
Duplication type:WGD
Function (paralog1):LOC100282713
Function (paralog2):hypothetical protein LOC100274095

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-1.1002494183885
Log2 mRNA fold difference:-0.63711404089267
Log2 TE fold difference:-0.57760248548694
Sequences
Protein sequence

MAAAVAEGSASSAAKEVEYQAGVQKLVDLLSNLNPAAKEFVPSAAASPPKKALSADAPVF
DYHSIGGGNGATDAAFYVGFGHQPRTRGNGYINQGRRRTNGRVRRADREDSIRRTVYVSE
LDHTVTEERLADIFTTCGQVVDCRICGDPHSVLRFAFIEFSDEEGARTALNLGGTIFGFY
PVRVLPSKTAILPVNPKFLPRTDDEKEMVMRTVYCTNIDKMVTQLDVKKFFEELCGEVSR
LRLLGDNVHSTRIAFVEFVHAEGAIMALNCSGMILGTLPVRVSPSKTPVKPRVNRVGSN*

MAAVAEGSASAAAKEVEYQAGVQKLVDLLSNLNPAAKEFVPSSAPAAAASPPKKALSADA
PVFDYRSTAGGNGATDDPFYVGFGNQQRKRGNGYINQGRRRTNDRLRRADREDSVRRTVY
VSELDHTVTEERLADIFATCGHVVDCRICGDPHSVLRFAFIEFSDEEGARTALNLGGTIF
GFYPVRVLPSKTAILPVNPKFLPRTDDEKEMVMRTVYCTNIDKMVTQLDVKKFFEELCGE
VSRLRLLGDNVHSTRIAFVEFVHAEGAIMALNCSGMILGTLPVRVSPSKTPVKPRVNRMG
SN*

Other information
Ka divergence:0.0275057KaKs divergence:-0.210181
GC content 1 (%):52GC content 2 (%):50GC content divergence:-0.02
Length 1 (bp):900Length 2 (bp):909Length divergence:0.005
MFE 1 (kcal):-330.1MFE 2 (kcal):-312.2MFE divergence-0.028