Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G051256-GRMZM2G051528
Species:maize
Duplication type:WGD
Function (paralog1):R2R3 Myb transcription factor MYB-IF35
Function (paralog2):R2R3 Myb transcription factor MYB-IF25

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-1.132708577736
Log2 mRNA fold difference:-1.6577733196318
Log2 TE fold difference:0.50735559469715
Sequences
Protein sequence

MGRAPCCEKVGLKKGRWTKEEDEVLARYIKEHGEGSWRSLPKNAGLLRCGKSCRLRWINY
LRAGLKRGNISEEEEDMIIKLHATLGNRWSLIAGHLPGRTDNEIKNYWNSHLSRRAADFR
DGVVVDIDLSKLPGGGKRRGGRASRGAVVAAAKEKKAKEKDDRGNSKVAEAEQQLRDTED
DDGGSVSTPRPQSDDCGTAQSEEEQAQASASGLTSDGHGPEEEEEEDPLALSEEMVSALL
APESPKLEVGPDGSCMDSYSGPPSGESGCGSSGPSGDVAQDLDLDDDKAIMDWDLMGLDI
STAGDMWDQLVWDYDETLVTEPEGGEEGHQQQDDVMSDLFFLDNL*

MGRAPCCGKVGLKKGRWTREEDEILARYIEEHGEGSWRSLPKNAGLLRCGKSCRLRWINY
LRAGLKRGNITEEEEDVIVKLHATLGNRWSLIAGHLPGRTDNEIKNHWNSHLRRRGRAGD
SRDDGVVVNIDLVKLPGGRRASSRGIVAAAKPAGKNKEKRKNGKGRNNVAEAEQQLEEED
ANVSTTTPRTQSHCASAAQSEEQAQASASGLTSEEDLLALSEEMVVSALLAPGSPKLLEV
GPDGSCVDGDGGLSGDSGRGSGGPSGDVAQELHLDDDAIMDWDSMGLDIPTADDTWNPLV
WDYDQTSLVPEPEGEGRRQRDEMMSDLFFLDNL*

Other information
Ka divergence:0.185477KaKs divergence:0.153482
GC content 1 (%):65GC content 2 (%):65GC content divergence:0
Length 1 (bp):1038Length 2 (bp):1002Length divergence:-0.018
MFE 1 (kcal):-464.02MFE 2 (kcal):-449.3MFE divergence-0.016