Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G051683-GRMZM2G010987
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100304381
Function (paralog2):anthocyanidin 5,3-O-glucosyltransferase

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MGGEMEATAAETGLAQRPVVLYPSPGMGHLVSMIELGKLLGARGLPVTIVVVEPPFNTGA
TAPFLAGVSAANPSISFHRLPKVERLPLVSTKHQEALTFEVIRVSNPHLREFLAAATPAV
LVVDFFCSIALDVAEELRVPAYFFFTSGAEVLAFFLHLPALHERATASFQDMGEEPVQVP
GIPPFPATHAILPVMERDDAAYDGFVKGCADLCRSQGVLVNTFRLLEQRAVETVAAGHCT
PPGLPTPPIYCIGPLIKSEEVLGKGGEECLAWLDAQPRASVVLLCFGSIGRFSAEQIREV
AAGLEASRQRFLWVVRAPPSDDPAKKFEKPPEPDLDALLPEGFLARTKDRGLVVKSWAPQ
RDVLAHASVGGFVTHCGWNSVLEAIMAGVPMVAWPLYAEQRLNRVFLEKEMQLAVAVAGY
DSDKGLVPAEEVAAKVRWIMDSEGGRMLRERTLAAMRQAKDALREGGESEATLAGLVDDW
KRT*

MEAAAAAETGLAQKPVVLYPSPGMGHLVSMIELGKILGARGLSVIIVVVEPPFNTGATAP
FLAGVSAANPSISFHRLPKVERLPPVKTKHQEALTFEVTRVSNPHLREFLAAASPAVLVV
DFFCSIALDVAEELRVPAYFFFTSGAEVLAFFLHLPAIHERTAASFQDMGKELVHVPGIP
SFPATHCILPTMERDDVAYDGFLKGCTDLCRSQGIMVNTFRSLEQRAVETVAAGHCTPPG
LPTPPIYCIGPLIKSEEVLGKGGEECLAWLDAQPRASVVFLCFGSIGRFSVEQIREVAAG
LEASGQRFLWVVRAPPSDDPAKKFERPPEPDLDALLPEGFLARTKDRGLVVRSWAPQRDV
LAHASVGGFVTHCGWNSVLEAVMAGVPMVAWPLYAEQRLNRVFLEKEMQLAVAVEGYDSD
EGIVAAEEVAAKVRWLLESDGGRMLRKRTLAAMRQAKDALREGGESEATLTGLVDEWKRI
*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):70GC content 2 (%):69GC content divergence:-0.007
Length 1 (bp):1452Length 2 (bp):1443Length divergence:-0.003
MFE 1 (kcal):-741.02MFE 2 (kcal):-724.87MFE divergence-0.011