Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G051848-GRMZM2G360677
Species:maize
Duplication type:TD
Function (paralog1):40S ribosomal protein S8
Function (paralog2):40S ribosomal protein S8

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-0.44562343623964
Log2 mRNA fold difference:-0.56678619183117
Log2 TE fold difference:0.11827197020706
Sequences
Protein sequence

MGISRDSMHKRRATGGKQKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR
LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLTHYGV
DIGRKKKTPAAKKDNAEGQEVEAAAEETKKSNHVTRKLEKRKEGRTLDPHIEEQFGSGRL
LACISSRPGQCGRADGYILEGKELEFYMKKLQRKKGKSAVA*

MGISRDSMHKRRATGGKQKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR
LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLTHYGV
DIGRKKKTPAAKKDNAEGQEVEAAAEETKKSNHVTRKLEKRKEGRTLDPHIEEQFGSGRL
LACISSRPGQCGRADGYILEGKELEFYMKKLQRKKGKSAVA*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):52GC content 2 (%):51GC content divergence:-0.01
Length 1 (bp):666Length 2 (bp):666Length divergence:0
MFE 1 (kcal):-221.3MFE 2 (kcal):-218.94MFE divergence-0.005