Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G051921-GRMZM2G051943
Species:maize
Duplication type:TD
Function (paralog1):hypothetical protein LOC100384000
Function (paralog2):Endochitinase A Precursor (EC 3.2.1.14)(Seed chitinase A)

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:4.6550940093734
Log2 mRNA fold difference:5.5201776371199
Log2 TE fold difference:-0.86449591961136
Sequences
Protein sequence

MVMAMANSATILTVVLALIGLALLRAAAPASAQNDCGSCPPGYCCSKFGYCGTSFDYCNG
NTCQSGPCTAGGAGSGGANVSGVVTDAFLSGIKSQAGSGCEGSSLSFYSRRAFLSAASSY
PGFARAGSEADGKRELAAFFAHVTHETGHFCYVSEVNKNNSYCNSSNTQWPCAPGKKYYG
RGPLQVSWNYNYGPAGRSVGFDGLGNPDMVAQDPVVSFKTALWFWMSNAHQVMPRGFGAT
IRAINGALECNGENPAAVNARVGYYKEYCEQFGVGPGNNLTC*

MANAPRILALGLLALLCAAAGPAAAQNCGCQPNFCCSKFGYCGTTDAYCGDGCQSGPCRS
GGGGGGGGGGGGGGSGGANVANVVTDAFFNGIKNQAGSGCEGKNFYTRSAFLSAVNAYPG
FAHGGTEVEGKREIAAFFAHVTHETGHFCYISEINKSNAYCDASNRQWPCAAGQKYYGRG
PLQISWNYNYGPAGRDIGFNGLADPNRVAQDAVIAFKTALWFWMNNVHRVMPQGFGATIR
AINGALECNGNNPAQMNARVGYYKQYCQQLRVDPGPNLTC*

Other information
Ka divergence:-0.449152KaKs divergence:-0.413592
GC content 1 (%):66GC content 2 (%):68GC content divergence:0.015
Length 1 (bp):849Length 2 (bp):843Length divergence:-0.004
MFE 1 (kcal):-401.15MFE 2 (kcal):-412.4MFE divergence0.014