Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G052422-GRMZM2G126732
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100191321
Function (paralog2):ACC oxidase20

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-1.7507704939887
Log2 mRNA fold difference:-5.1993124582452
Log2 TE fold difference:3.402002568259
Sequences
Protein sequence

MAATVSSFPVVNMEKLETEERATAMEVIRDGCENWGFFELLNHGISHELMDEVERLTKAH
YATFREAKFQEFAARTLEAGEKGADVKDVDWESTFFVRHLPASNLADLPDVDDRYRQVME
QFASEIRKLSERLLDLLCENLGLEPGYLKAAFAGSDGPTFGTKVSAYPPCPRPDLVDGLR
AHTDAGGIVLLFQDDQVSGLQLLRGGEWVDVPPMRHAIVANVGDQLEVITNGRYKSVMHR
VLTRPDGNRMSVASFYNPGADAVIFPAPALVGAAEEDRAEAAYPSFVFEDYMNLYVRHKF
EAKEPRFEAMKSAIATA*

MAATVSFPVVNMEKLETEERDTAMAVIRDACENWGFFELLNHGISHELMDEVERLTKAHY
ATFREAKFQEFAARTLAAAGDEGADVSDVDWESTFFVRHLPASNLADLPDVDDHYRGGSS
VQCVSIPSTASEFLPDVDDAHSYPIIPLPLSSVHQIECCVRPATITITSHSRQVMKQFAS
EVQKLSEKVLDLLCENLGLEPGYLKAAFAGSDGGPTFGTKVSAYPPCPRPDLVAGLRAHT
DAGGLILLLQDDQVSGLQLLRGGDGGEWVDVPPLRHAIVANVGDQLEVVTNGRYKSAVHR
VLARPDGNRMSVASFYNPGADAVIFPAPALVGEEERAEKKATTYPRFVFEDYMNLYARHK
FEAKEPRFEAMKSSAIATA*

Other information
Ka divergence:0.375608KaKs divergence:0.329559
GC content 1 (%):68GC content 2 (%):66GC content divergence:-0.015
Length 1 (bp):954Length 2 (bp):1140Length divergence:0.089
MFE 1 (kcal):-468MFE 2 (kcal):-538.06MFE divergence0.07