Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G052471-GRMZM2G099474
Species:maize
Duplication type:WGD
Function (paralog1):thioredoxin-like protein 1
Function (paralog2):thioredoxin-like protein 1

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-1.7481494395008
Log2 mRNA fold difference:-1.3982635637548
Log2 TE fold difference:-0.3403433301579
Sequences
Protein sequence

MNAASTAAAAPAPAATVQVPRGQVDLIDFIDWTGVECLNQDSSHSIVNALKQSLRDDEGL
YLASDSDEQLLIYIPFMQVVKLHSALFKGPEEEGPKTVKLFSNKEHMGFSNVNDYPPSDT
LELSSDHLIENKLLPLKYVKFQNVRSLTIFIEDNQSGSDVSKIHKIALYGTTVDTTNMKD
LKKIEEH*

MDAASIAAAAAAVATPPPGPAVTVQVPRGQVDLIDFIDWTGVECLNQDSSHSIVNALKQS
LRDDEGLYLASDSDEQLLIYIPFMQVVKLHSVLFKGPEEEGPKTVKLFSNKEHMGFSNVN
DYPPMDTLELSSDHLIENKPLPLKYVKFQNVRSLTVFIEDNQSGSDVSKIQKVALYGTTV
DTTNMKDLRKTEEH*

Other information
Ka divergence:0.819371KaKs divergence:0.779805
GC content 1 (%):51GC content 2 (%):52GC content divergence:0.01
Length 1 (bp):564Length 2 (bp):585Length divergence:0.018
MFE 1 (kcal):-171.8MFE 2 (kcal):-181.2MFE divergence0.027