Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G052562-GRMZM5G835276
Species:maize
Duplication type:WGD
Function (paralog1):Zea nodulation homolog1
Function (paralog2):alpha-L-fucosidase 2

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-1.9091381859512
Log2 mRNA fold difference:-4.1754341574787
Log2 TE fold difference:2.3330417055005
Sequences
Protein sequence

MAAQLAVAFLALLSSSAFLAVSGQKFNAIFSFGDSMSDTGNLCVNGPPAGLTLTQPPYGE
TFFGRATCRCSDGRLVVDFLAEKFGLPLLKPSKQGGSDFKQGANMAIIGATTMDSGFFQS
LGIADKIWNNGPLNTQIQWFQQLMPSICGSTQACKSYLSKSLFVLGEFGGNDYNAQIFGG
YTPEQASGQSATIVDAIGKGVEQLISLGAMYVVVPGVLPVGCFPIYLTLYQTSSAGDYDQ
YGCLKRFNALSAQHNSLLQAKVSSLQSKYPGARVMYADFYSHVYDMVKSPGSYGFSTNLR
ACCGAGGGKYNYQNGARCGMPGAYACSDPASSLSWDGIHLTEAAYRKIADGWVSGAYCHP
AISA*

MAARRLLVAFLALCSGFSAVHGQKFNAIFSFGDSMSDTGNLCVNGPPTGLTLTQPPYGET
FFGRATCRCSDGRLVVDFLAEKFGLPLLKPSKQGGANFKQGANMAIIGATTMDSGFFQSL
GIAGKIWNNGPLNTQIQWFQQLMPSICGSRQACKSYLSKSLFVLGEFGGNDYNAQLFGGY
SPEQASRQSGTIVDAIGRGVEQLIRLGATHVVVPGVLPVGCFPIYLTLYRTSNAGDYDRH
GCLRRFNALSARHNALLQRKVSGLRGRYPGARIMYADFYAHVYDMVRRPASYGFSANLRA
CCGAGGGKYNYQNGARCGMPGAHACSNPSSSLSWDGIHLTEAAYRKIADGWVSGAYCHPP
ISA*

Other information
Ka divergence:0.516965KaKs divergence:0.130975
GC content 1 (%):66GC content 2 (%):68GC content divergence:0.015
Length 1 (bp):1095Length 2 (bp):1092Length divergence:-0.001
MFE 1 (kcal):-518.7MFE 2 (kcal):-530.4MFE divergence0.011