Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G052667-GRMZM2G148333
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):ethylene response factor

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-0.31422323389516
Log2 mRNA fold difference:0.45509824628684
Log2 TE fold difference:-0.80168993583629
Sequences
Protein sequence

MCGGAILSGFIPPSGVAAAAAAAKKQQQQQQRCRVTADLLWPGPGSKGAPQDKEEDFEAD
FREFERGLGEDDVDSAGEGGDPEVQELPPPEPTRFAFATAAKAAVDGVMTPPPKDVQGDR
AVKKRGRKNQYRGIRQRPWGKWAAEIRDPNKGVRVWLGTYNTAEEAARAYDAEARKIRGK
KAKVNFPDDATGTRHRPTTDEIFNNLKNDDNNNNDDLFAMFAFGDNKKKVPAAKPAAAEG
GSGSGSFLVPAPAVAVVPGNKRRSSATNTMLSVSDDQRSNSYGSGSSDLVGSWSWDDDAA
AAAMTSDYTSSVFAPDNAVLPAASYTQGGAPKRMRSSYGGAPPSLAHDAAMPGFGLDKVS
YHHYQALPPYYVGSSNASVGNLGLLQQADDAPAPQDGASAGDIWSLDELLMLAAAGAY*

MCGGAILSGFIPPSGVPAAAAAAKKKQQRRATADLLWPGPGKKGAPREEDFEADFREFER
GLGEDDDVDGAGDEVQELPLPEPARLAFAAAVGAPRTAVDGVMTPKDGEGDMPTTATNSA
ANKRRRKNQYRGIRRRPWGKWAAEIRDPSKGVRVWLGTYSTAEEAARAYDAEARRIRGKK
AKVNFRDEAAAAAGAQKAPAATTPTACGNAARLGPPPPPPKFRADEVFGNMNGGTGSNDL
FAIMFAFSDSSSKVVRVEPGEGAAGFLPADLLPGSKRSAANMLLLSDQSSDSYGSCDLGW
EWDWDDDTMTSDYASVFAPAAPSNVVPAWYTQGGPVSKRTRSSYGYGAAMPGGFDPETNY
QYQPLPYVVESSPSDGASTDDMDCLQMMRAGDVPQDGASSGGGGGDGGDIWSLDELLMAA
GAY*

Other information
Ka divergence:0.227336KaKs divergence:0.0445259
GC content 1 (%):63GC content 2 (%):64GC content divergence:0.008
Length 1 (bp):1257Length 2 (bp):1272Length divergence:0.006
MFE 1 (kcal):-555.63MFE 2 (kcal):-583.25MFE divergence0.024