Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G053019-GRMZM2G353213
Species:maize
Duplication type:WGD
Function (paralog1):translocon Tic40
Function (paralog2):translocon Tic40 (LOC100285102), mRNA

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0.72017918713536
Log2 mRNA fold difference:1.0847586999044
Log2 TE fold difference:-0.36483904386058
Sequences
Protein sequence

MESLVLASSCSPSPRLPLLSPSARFRRLPGSMPQAPASTSGATRKGLRRHMLFVAAATAT
PSGSRNVFKELRAKGFASMSSSTANENMSTETGTLPPMPPPSSYIGSPVFWIGVGVALSV
AFTTVSSMLKKYAMEQAFKSMMTQAPPNSFGSNSPFPFGMPPQASPTAPSSFSYLEPRKG
TSPQVSTVDVSATEVDAAGTSKEVDVTETPKPSKNFAFVDVSPEDLQQKDLQSSLEMVDV
KHDSTESESKEDTEEKAPRNGATFKLNEDAARGPTESSQSGPMLSVETIEKMMEDPAVQK
MVYPYLPEEMRNPDSFKWMLQNPMYRQQLQDMLKNMGGSPDQWDNRMLDHLKNFDLSSPE
VRQQFAQVGMTPEEVVSKIMANPDVAVAFQNPKIQTAIMDCSQNPLNIVKYQNDKEVMDV
FMKISQIFPQING*

MESLILASSCSASPRLPLLSSAARFRGLPVSVPPPSSASISGAARKGPMRPRLFVAAAAA
PRGSGNVFEGLRAKGFASMSSSTGNENMSTGTGTLPPMPPTSSYIGSPVFWIGVGVALSV
AFTTVSSMLKRYAMQQAFKSMMTQSAPNSFGSNSPFPFSMPPQASPTAPSTYPYLEPKKD
TSPHVSTVDVSANEVEATGTSKEVDVTETPKPSKKFAFVDVSPEELQQKNLQSSPETVDV
KHDSTYSESKEDTEEQVPTISTNTESKEDTEEKVPTNGASFKLNEGAAHGPTESNNSASM
LSVETIEKMMEDPAVQKMVYPYLPEEMRNPNSFKWMLQNPMYRQQLQDMLNNMGATPDQW
DNRMLDHLKNFDLSSPEVRQQFAQVGMTPEEVVSKIMANPDVAVAFQNPKIQTAIMDCSQ
NPLNIVKYQNDKEVMDVFMKISQIFPQING*

www.000webhost.com

Other information
Ka divergence:-0.188286KaKs divergence:-0.221254
GC content 1 (%):49GC content 2 (%):48GC content divergence:-0.01
Length 1 (bp):1302Length 2 (bp):1353Length divergence:0.019
MFE 1 (kcal):-405.12MFE 2 (kcal):-425.03MFE divergence0.024