Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G053223-GRMZM2G048551
Species:maize
Duplication type:WGD
Function (paralog1):RNA binding protein
Function (paralog2):RNA binding protein

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MSRRRRGGSDSDGEDDSFLYRYPLPSVAASEGGGGKPRGGGGGSGGLAPSKSTVYVSNLD
FALTNSDLHLLFSRFGRVARVTVLKDRESRRSRGVAFVLFVSREDAAAAAAEMHGKVLNG
RTLSASIAADNGRAAEFIRRRVYRDKSRCYECGEEGHLSYECPRNQLGPRERPAPSKKSR
RGGGGGGGGRGRGRGGQADWHSDDDEDAAAAVAFEDDKWASVVDTREVEEKAAGKGEGMG
KAARREKRKCYFSDESDEDDD*

MSRRRRGGSDSDGEDNSFLYRYPLPSAAASAGVSAGGSGKPRGGGSGGLAPSKSTVYVSN
LDFSLTNSDIHLLFSRFGRVARVTVLKDRESRRSRGVAFVLFVLREDAAAAAAEMHGKVL
NGRTLSASIADDNGRAAEFIRRRVYRDKSRCYECGEEGHLSYECPRNQLGPRERPAPSKK
SRRGGGSGGGTGGRGRGRGGEADWHSDDDEDAAAAAAFEDDRWASVVDTRGEEEKSAGKE
EGKKKGKAARKEKRKGYFSDESDEDED*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):68GC content 2 (%):68GC content divergence:0
Length 1 (bp):786Length 2 (bp):804Length divergence:0.011
MFE 1 (kcal):-410.29MFE 2 (kcal):-396.3MFE divergence-0.017