Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G053319-GRMZM2G078941
Species:maize
Duplication type:WGD
Function (paralog1):LOC100284264
Function (paralog2):LOC100283798

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-0.18511704809804
Log2 mRNA fold difference:0.38126888026091
Log2 TE fold difference:-0.49006184334305
Sequences
Protein sequence

MEGGDSSGAGAGSGGAVAAAAKWRSDASRSFQYYLDRSTPHATGRWLGTLAAAAIYALRV
YMAQGFYIVTYGLGIYLLNLLIGFLSPMVDPELDPSAAAEGPALPTRGSDEFKPFIRRLP
EFKFWYAITKAFVVAFVMTFFSVFDVPVFWPILLCYWVVLFVLTMKRQIVHMIKYKYVPF
SIGKQKYGVKKSVASTSSSKD*

MEGGDSSGAGAGGAVAAAAKWRSDASRAFQYYLDRSTPHATGRWLGTLAAAAIYALRVYM
VQGFYIVTYGLGIYLLNLLIGFLSPMVDPELDPSAASEGPALPTRGSDEFKPFIRRLPEF
KFWYAITKAFVIAFVMTFFSVFDVPVFWPILLCYWIVLFVLTMKRQIVHMIKYKYVPFSI
GKQKYGGKKSAVSPSSSKD*

Other information
Ka divergence:-0.209804KaKs divergence:0.245681
GC content 1 (%):59GC content 2 (%):59GC content divergence:0
Length 1 (bp):606Length 2 (bp):600Length divergence:-0.005
MFE 1 (kcal):-262.87MFE 2 (kcal):-262.07MFE divergence-0.002