Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G053610-GRMZM2G086943
Species:maize
Duplication type:WGD
Function (paralog1):Putative uncharacterized protein
Function (paralog2):hypothetical protein LOC100192800

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:1.3831445171754
Log2 mRNA fold difference:1.1903652616929
Log2 TE fold difference:0.18157018224129
Sequences
Protein sequence

MDWSAVTAEDLVDALREVDWSTPPRTVSEFFSRFTVPRSYSKWTSRLKCNLYYYRTNYFI
LIMFILGMGFLWKPVAILAAFMTGLSIAFLNDSFAVTFNEKVTRTVRQFSPHLAAKMRPP
ITPVLRGRPNSKRSIHICGRPRRVFVIFFSAVSCILWLTSCSLLTVLWALLIALFATVLH
ASFRTPNLKARLNTFREEFRAVWRNYSEL*

MDWSAVTAEDLVDALREVDWSMPPRPVPEFFSRFTVPRSYSKWTSRLKCNLYYYRTNYFI
LIMFILGMGFLWKPVAIVAAFMTGLSIAFLNDSFAVTFNEKVTRTVRQFSPHLAAKLRPP
ITPVLRGRPSSKRSIHICGRPRWVFVLFFSAVSCILWLTSCSLLTVLWALLIALFATVLH
ASFRTPNLKARLNTFREEFRAVWRNYSEL*

Other information
Ka divergence:0.00331717KaKs divergence:-0.161491
GC content 1 (%):49GC content 2 (%):49GC content divergence:0
Length 1 (bp):630Length 2 (bp):630Length divergence:0
MFE 1 (kcal):-210.04MFE 2 (kcal):-207.82MFE divergence-0.005