Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G053627-GRMZM2G095689
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100277316
Function (paralog2):hypothetical protein LOC100276596

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:3.9501357627958
Log2 mRNA fold difference:3.5194407175526
Log2 TE fold difference:0.37228230176147
Sequences
Protein sequence

MGSGKASSPPGAAAGGSAPPPGGAVVCCMCGDRGVLSELFRCSACSVRSQHTYCTDRYPK
AESYGTCNWCLRADGRVASTSNSPRSAGKAAARPPSHGGDTIGSGRSPKVAARGDFASSN
LSKPVKKQHAQRILLRRSASDLGSRVPTDHNAPPSPGVARGRPKVRRYKLLEEVISS*

MGSGKASSPPGPTAGGRGSPPGAAVCCMCGDRGLLPELFRCSACSVRSQHTYCTDRYPKV
ESYGVCNWCLRADGGVASTSNSPRSAGKAVVQRPAPHGGDKIGSGTSPKAAARGDFASSN
LSKPIKKQPQQHAQRLLLRRSASDLGSRVVRTDHDAPPSPGVTTRGRPRVRRYKLLEEVI
TS*

Other information
Ka divergence:-0.113683KaKs divergence:-0.558051
GC content 1 (%):68GC content 2 (%):67GC content divergence:-0.007
Length 1 (bp):534Length 2 (bp):549Length divergence:0.014
MFE 1 (kcal):-269.09MFE 2 (kcal):-269.6MFE divergence0.001