Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G053720-GRMZM2G117956
Species:maize
Duplication type:WGD
Function (paralog1):proline oxidase
Function (paralog2):proline oxidase

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-3.025897978219
Log2 mRNA fold difference:-3.3484264187371
Log2 TE fold difference:0.31336777611372
Sequences
Protein sequence

MAIASRATKRALSTFAAAKLPEEAVAAAAAGEAIAARSHQAVPLPPAPASSVRPLQFEDT
GRLFAGEPTSALLRTLAALQALSVGPLVDAATAALRSPAVAGSALGRAAARATAYRHFCA
GETADEAAAVVRRLWRGGMGGILDYGIEDAEDGHACDRNAAGFVSAVDVAASLPPGSASV
CIKITALCPIALLEKASDLLRWQKKHPSFSLPWKTHSFPVLSDSSPLHLTASEPAALTAE
EERELQLAHSRLLAVCARCAEHGIPLLVDAEYATVQPAIDYFTLVGALAFNDAGAADGGR
PIVHGTIQAYLRDARDRLEAMVRGAERERVRLGLKVVRGAYLTREARLAAALGVPSPVHG
SIQETHDCYNGCAAFLLDRVRRGSASVMLATHNVESGQLAAARAQELGIPKGDRNLQFAQ
LMGMADGLSLSLRNAGFQVSKYLPYGPVEQIIPYLIRRAEENRGLLSASSFDRQLLRKEL
VRRVKAMVAGRE*

MAIASRATKRALSTFAAAKLPEEAIAATAAVPVPLAPAPASSERALLQFEDTGRLFAGEP
TPALLRTLAALQALSVGPLVDAATAALRSPAVAGSALGRAAARATAYRHFCAGETAGEAA
AAVRRLWRGGMGGILDYGIEDAEDGGACDRNAAGFASAVDVAAKLPPGSASVCIKITALC
PIALLEKASDLLRWQKRHPSLNLPWKTHDFPILSDSSPLHLTASEPPALSAEEERELELA
HERVLAVCARCAERGVPLLVDAEYAAVQPAIDYLTLAGALACNAERSIVHGTVQAYLRDA
RERLETMARGVERARVRLGVKLVRGAYLAREARVAAALGVPSPVHGSIRETHDCYNGCAA
FLLDRVRRGSASVVLATHNVESGQLAAARAEELGIPRGDRNLQFAQLMGMADGLSLGLRN
AGFQVSKYLPYGPVEQIVPYLIRRAEENRGLLSASSFDRQLLREELVRRFKAAVLGRE*

Other information
Ka divergence:0.565522KaKs divergence:0.280078
GC content 1 (%):74GC content 2 (%):74GC content divergence:0
Length 1 (bp):1479Length 2 (bp):1437Length divergence:-0.014
MFE 1 (kcal):-825.78MFE 2 (kcal):-838.8MFE divergence0.008