Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G053764-GRMZM2G146374
Species:maize
Duplication type:WGD
Function (paralog1):ubiquitin-conjugating enzyme E2-21 kDa 1
Function (paralog2):hypothetical protein LOC100193596

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:4.2045695282482
Log2 mRNA fold difference:3.2087403043593
Log2 TE fold difference:0.98022665904951
Sequences
Protein sequence

MSSPSKRREMDLMKLMMSDYKVEMVNDGMQEFFVEFKGPAESIYQGGVWKVRVELPDAYP
YKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL
NGEAAALMMRDRPVYEQKGKGEGRTTTRTHRQSLQAAQSLSPSYPQGEELRGGGGPSAAV
LVSPLSKMSSPSKRREMDLMKLMMSDYKVEMVNDGMQEFFVEFKGPAESIYQGGVWKVRV
ELPDAYPYKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLY
PNPSDPLNGEAAALMMRDRPVYEQKVKEYCEKYAKPEDAGITPEDKSSDEELSEEEDDSG
DEAILGNPDP*

MIHVGWGEMGFRRTANLPCRSCSDILVRLASSSIGCSVDLKRPFFFSHTFFFLSHELVLH
LVGIYQGGVWKVRVELPDAYPYKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDL
VNVFEVFLPQLLLYPNPSDPLNGEAAALMMRDRPVYEQKVKEYCEKYAKPEDAGITPEDK
SSDEELSDDDDDDNDSGDEAILGNPDP*

Other information
Ka divergence:0.951075KaKs divergence:0.999516
GC content 1 (%):48GC content 2 (%):46GC content divergence:-0.021
Length 1 (bp):1113Length 2 (bp):624Length divergence:-0.282
MFE 1 (kcal):-343.86MFE 2 (kcal):-186.85MFE divergence-0.296