Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G053909-GRMZM2G140924
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100194314
Function (paralog2):zinc finger, C3HC4 type family protein

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-1.3524132186898
Log2 mRNA fold difference:-1.3127878883179
Log2 TE fold difference:-0.052993838357506
Sequences
Protein sequence

MDEHMGRRTVGGLLFTKGGSILLFREDGSRPKAKNCCTRHGCSGQHPADRAKGKEVHRAA
AVGSESTPATPRRSQAFRKPNRRPPHEGSASGSIVRDVGGPCSETGSGSRDAPGRDLLAR
LKERVNTSRKRSLNRENSPQSPSGLSVCASSPSNSRSVSRPSHRTASRIREADEGANAGA
DSVVRRNAARRGSERSDDDLLLVEQVTRNQAPSEGFLSGFMARYRSDLQGELSSLDDSME
DPNGYLRFDVGGIEELENYFIFNDRHRGMRMDIDGMSYEELLALGERIGTVNTGLSDDAL
SACLNRRLYMPTASGSHEDCERKCSVCQEEYLAGEEVGEMACKHYYHLSCIDHWLRQKNW
CPICKSVALKIN*

MEEHMGRRTVGGLLLTKGGSILLFREDGSRPRAKNCCSRHGCSGHHSVGKAKGKEVHRAA
VANESTPATPRRPKICRNPDRMPPHGTSAPGSISKDAGGSCSETGNRSRDTPGPGRDLLA
RLKERVNTSRKRSLNRENSPQSPSGFTASSPSNSRSVSLSRPSHRAASRVRRADEGANAG
ADSVHRNGAGGARRSSQRGDAGLLLVEQQVARNHVPSEGFLSGFMARYRSGLQEGLSSLD
DSVEDSNGYLRFDTGGIEELQNYLIFSDRHRGMRMDIDGMSYEELLALGERIGTVKTGLS
DDALSTCLNRSLYMPTAPGSHEDCETKCSICQEEYLSGEDVGKMACKHYYHLSCIEHWLR
QKNRCPICKSVALKTK*

www.000webhost.com

Other information
Ka divergence:0.0617418KaKs divergence:0.0552887
GC content 1 (%):54GC content 2 (%):53GC content divergence:-0.009
Length 1 (bp):1119Length 2 (bp):1131Length divergence:0.005
MFE 1 (kcal):-424.7MFE 2 (kcal):-417.2MFE divergence-0.009