Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G054032-GRMZM2G125004
Species:maize
Duplication type:WGD
Function (paralog1):F-box protein
Function (paralog2):

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-0.65370920837304
Log2 mRNA fold difference:-0.27992502355987
Log2 TE fold difference:-0.39644426862304
Sequences
Protein sequence

MAATLDGAAGCRKRKRAAPGLADLHDDMLERVLARLPPASYFRLRGVSRRWRAAAESRSF
RAACARVTARDPWFLMLEDSDHQDQDQDERRPRPAAVFDSAERALARWRGAPVPLQPVAA
ASGLVLYRDPSTGGLTVVNPLTGASRALPPPARVAGALQAVAMYGSPYRVVLILGELPEL
STVAYDSSTNAWSEQAALSRKPEVEGAPSRERVAEVGDGDGDDTVYFLSKSGDVVASTMQ
RSASRQYSSAVACGGCGGGDAVAYFLSRSGTVVACDLARRAFAELPRILPAYHEHSIDVV
ACGGAAYAVVLSEFLDAASLRVWEFAGGAWRQVAAMPPAMAHGFRGAKADVNCVGHGGRL
MVCVSSSSAGAGGCFLCDVGTNRWEELPRRAAGDGDATTGFVSALSFEPRIEAAV*

MGPTLDGAAGGGKKRKRVPPGLADLHDDMLERVLARLPPASYLRLRGVSRRWRAAAESST
FRAACARVTARDPWFLMLDDPDHQDEQRPRYTAAAVVFDAAERAWARWRGAPGPQRPVAA
AGGLLLYRDPGTGDLTVVNPLTGAAHALPPPPPPALTRALQAIAMYGAPYRVVLILGELP
DLSTVAYDSSTDAWGEEAALSRKPEEEGGGGGGDGTVYFLSKSGDVVATTTQRSAARQYS
SAVACGAGADAVAYFLSRSGTVVACDLARRAFAELPRILPAHHEHSVDVAACGGAAYAVV
LSEFLDAASLRVWEFARGAWRQVAAMPPAMAHAFRGAKADVNCVGHGGRVMVCVSSSSSS
ASGCFMCDVRTNRWEELPRRQGGDGDGSTGFVAALSFEPRMEAAV*

Other information
Ka divergence:-0.0756897KaKs divergence:-0.404528
GC content 1 (%):75GC content 2 (%):75GC content divergence:0
Length 1 (bp):1248Length 2 (bp):1218Length divergence:-0.012
MFE 1 (kcal):-737.9MFE 2 (kcal):-707.11MFE divergence-0.021