Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G054115-GRMZM2G181135
Species:maize
Duplication type:TD
Function (paralog1):hypothetical protein LOC100273094
Function (paralog2):hypothetical protein LOC100383587

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-1.5768064449807
Log2 mRNA fold difference:-1.308395001433
Log2 TE fold difference:-0.19210407405827
Sequences
Protein sequence

MEAAGGEQHETRRRAGAGLALLGVVYSSLLLNAIFVAHHFLSPSRLLLRDDGCGCGLTWS
LQAAREAEAVAAVECSGHGQVFVDGVAGEDGRPGCECNSCFGGPDCSLRTPNCTADADSG
NPLFLEPYWRRHAAASAVVFSGWHRMSYTTTGGFQSVELERQIRRLHGAVGNAVADDKHL
VFASGSLQLINALVHALSPDATAASPPSRVVAAAPYYPAYRQQTSMFDGREYRWAGTTAL
WANSSRANSTDGTFIEFVTSPNNPDALLREPVLRGSAAAIVDHAYYWPHFTHIPAPADED
IMMFTVSKPSGHAGSRFGWALIRDDEVAKRALEYLRDSNMGASRDTQLRMLGIFKFMLAN
LRGKDDIFAFGHDVMRSRWLRLSAAVSRTRRITLQKIAPQYCTYFGRVREPSPAYAWVKC
EMEEDEDCYEALLKANIITRSGVQYEASSRYTRISLLKSDDDFDVLMERLEDLVDADKYD
DSNGSSSM*

MEAAEERPRRRPAGLGVLALLCSSLLLNVLFLAYYYFLSPPSQLADGGSCGLSWALRAAR
DAEALAATDSCSGHGQVFLDGVVGEDGRPGCECNRCFDGPHCSIRTPNCTADATSGDPLF
LEPYWKRHAAASAVLVPGWHRLSYATTDGLFQSVELENHIRRLHRAVGNAVVDGKRLVFG
AGSTQLINALVHALSPDANAAAASPPARVVATAPYYPPYRTQTAMFDGREYRWEGTTAAA
WANASRNSSSFIEFVTSPNNPDALLRAPVLRGSAVIADHAYYWPHFTHIAAPADEDVMLF
TMSKPSGHAGSRLGWALIRDEKVAKRAYEYVQSSIMGASRDTQLRMLEIVKVMLANLHGE
EDIFAFGHDVMRTRWRRLSAVVSRSRRISLQRINPQYCTYFNRVREPSPAYAWVKCEREE
DDDCYEALLKARIITRSGAGYDASSRYTRVSLLKSDDDFEVLVERVTDLVNAENYDDDVP
RGSSSM*

Other information
Ka divergence:0.0281551KaKs divergence:0.000672043
GC content 1 (%):66GC content 2 (%):65GC content divergence:-0.008
Length 1 (bp):1467Length 2 (bp):1461Length divergence:-0.002
MFE 1 (kcal):-695.56MFE 2 (kcal):-679.94MFE divergence-0.011