Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G054136-GRMZM5G851698
Species:maize
Duplication type:WGD
Function (paralog1):ribosomal proteinS6
Function (paralog2):ribosomal protein s6 RPS6-2

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:2.051228926508
Log2 mRNA fold difference:2.3763245608921
Log2 TE fold difference:-0.27284404258188
Sequences
Protein sequence

MKFNIANPSTGCQKKLEIDDDQKLRAFYDRRISQEVSGDALGEEFKGYVFKIMGGCDKQG
FPMKQGVLTSGRVRLLLHRGTPCFRGYGRRNGERRRKSVRGCIVSQDLSVINLVIVKKGE
NDLPGLTDTEKPRMRGPKRASKIRKLFNLNKDDDVRKYVNTYRRTFTTKNGKKVSKAPKI
QRLVTPLTLQRKRARIADKKKRITKKKSEAAEYQKLLAQRLKEQRDRRSESLAKRRSKLS
AAVKASAATSA*

MKFNIANPSTGCQKKLEIDDDQKLRAFYDRRISQEVSGDALGEEFKGYVFKIMGGCDKQG
FPMKQGVLTSGRVRLLLHRGTPCFRGYGRRNGERRRKSVRGCIVSQDLSVINLVIVKKGE
NDLPGLTDTEKPRMRGPKRASKIRKLFNLAKDDDVRKYVNTYRRTFTTKNGKKVSKAPKI
QRLVTPLTLQRKRARIADKKKRIAKKKSEAAEYQKLLAQRLKEQRDRRSESLAKRRSKLS
AAAKASAATSA*

Other information
Ka divergence:-0.928571KaKs divergence:-0.997972
GC content 1 (%):52GC content 2 (%):52GC content divergence:0
Length 1 (bp):756Length 2 (bp):756Length divergence:0
MFE 1 (kcal):-260.9MFE 2 (kcal):-267.92MFE divergence0.013