Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G054201-GRMZM2G121075
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100216970
Function (paralog2):60S ribosomal protein L12

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:1.1861591066797
Log2 mRNA fold difference:1.6906881031369
Log2 TE fold difference:-0.5223003711328
Sequences
Protein sequence

MPPKLDPSQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT
VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKVKNIKHSGNISLDDVIEIARTMRPR
SMAKEMSGCVKEILGTCVSVGCTVDGKDPKDLQQEIDDGEDWSLGGLSVY*

MPPKLDPSQVVEVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT
VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKVKNIKHSGNISLDDVIEIARTMRHR
SMAKELAGTVKEILGTCVSVGCTVDGKDPKDLQQEIDDGEVEIPSA*

Other information
Ka divergence:-0.827469KaKs divergence:-0.908029
GC content 1 (%):61GC content 2 (%):64GC content divergence:0.024
Length 1 (bp):513Length 2 (bp):501Length divergence:-0.012
MFE 1 (kcal):-207.7MFE 2 (kcal):-206.6MFE divergence-0.003