Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G054250-GRMZM5G891834
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:1.2490783446861
Log2 mRNA fold difference:1.3172676631237
Log2 TE fold difference:-0.044927134193816
Sequences
Protein sequence

MAGAEGRGPRRSRVAFVLVDGIGDVSVPSLGGRTPLEAACTPRLDAVAAVGVTGLMDPVE
PGLACGSDTAHLSLLGYDPRVYYRGRGAFESMGAGLAMAPGDIAFKSNFATLDESTGVII
SRRADRHFEEEGPILCAALDGMRLPSFPEYEIRVRYATEHRCGVVVKGPKLSGNISGTDP
LKDNRLHLKAEPLDDSQEAKNSAAVINELSKEITHILVSHPINAQRAAEGKNIANVVLLR
GCGIRIEVPAFETKHGLAPCMVAPTKIIAGLGLSLGIDILEAPGATGDYRTLLTSKAKAI
AKALSSPMGTPPRVFVPGEDEYKAGKENGYDFGFLHIKAIDDAGHDKAVKLKVRGLEAVD
RAFGQLARLLWEAENAGHYQYFLCVTGDHSTPVEYGDHSFEPVPFAICRLRDYAGAVGVD
NIINTQLDAFPLPSVKSGEDLLDNIESLDHKPDQLKAFSGDTVCEFNEIATARGCLGRFP
GSEMMGIIKKFIKAKND*

MAGAEGRGPRRSRVAFVLVDGIGDVSVPSLGGRTPLDAACAPRLDAVAAAGVTGLMDPVE
PGLACGSDTAHLSLLGYDPREYYRGRGAFESMGAGLAMAPGDIAFKSNFATLDENTGVII
SRRADRHFEEEGPILCAALDGMKLRSFPEYEVRVRYATEHRCGVVVKGPKLSGNISGTDP
LKDNRLHLKAEPLDGSEEAKNTAAVVNELSMEITRILVSHPINAKRAAEGKNIANVVLLR
GCGIRIEVPAFETKHGLAPCMVAPTKIIAGLGLSLGIDILEAPGATGDYRTLLTSKAKAI
AKALSAPMDTPPRVFVPGEDGYKAGKENGYDFGFLHIKAIDDAGHDKAVKLKVRGLEAVD
RAIGQLARLLWEAEKAGHYQYFLCVTGDHSTPVEYGDHSFEPVPFAICRLRDYAGAIGED
NIMNTQLDDFPLPSVKSGEDLLDSIESLEHKPGQLKAFSGDSVCEFNEIAAARGCLGRFP
GSEMMGIIKKFIKAKND*

Other information
Ka divergence:-0.483693KaKs divergence:-0.567582
GC content 1 (%):52GC content 2 (%):53GC content divergence:0.01
Length 1 (bp):1494Length 2 (bp):1494Length divergence:0
MFE 1 (kcal):-562.5MFE 2 (kcal):-562.27MFE divergence0