Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G054252-GRMZM2G100583
Species:maize
Duplication type:WGD
Function (paralog1):LOC100281072
Function (paralog2):NAC domain-containing protein 68

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-0.43118265863686
Log2 mRNA fold difference:-0.92035194025988
Log2 TE fold difference:0.50267938514272
Sequences
Protein sequence

MSAERAPVLVRHGGGGVEALRQLPPGFRFRPTDEELVVQYLRRKAIGVPLPAAVIPVFRD
LYSRDPWDVVAVSAPADTRSEGEKYFFAVRPASGGKSSGAGTGSRAAAGGRWKPSGKEKP
VVLPRPCGGGSLLVGVKRAMTFVPRRRKKTAALPSAALKTGWVMHEYRLAAPLHKNGCSL
AQAQGEWVVCRVFQKGGNRPRRRQREASPPPSASSSCVTDASSSDLDEVSS*

MLAAWRSCGSSRRGSGSAPRTRSSWCSTSGARPWARRSPPPSSPSSATSTASTPGTPSTC
RPPLVHTRSTTALRTTSSIHRFCQYSVVVGERTKIASFFLCFFPTIDPDASSQGERYFFA
VRPAGGVGSARRATASGRWRPAGKEKPVALPRPCGGGSLLVGVKRAMAFVPRRKKKKAAA
AAALAIGWVMHEYRLAAPLHKHGCSLAQAQGEWVVCRVFQKGSGRPRRRRQRPVSPSPSS
ASSCVTDGSSSSSSDMDEVSS*

Other information
Ka divergence:0.686901KaKs divergence:-0.379385
GC content 1 (%):71GC content 2 (%):68GC content divergence:-0.022
Length 1 (bp):696Length 2 (bp):786Length divergence:0.061
MFE 1 (kcal):-366.7MFE 2 (kcal):-388.1MFE divergence0.028