Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G054277-GRMZM2G179049
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100381893
Function (paralog2):NAC domain-containing protein 18

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-1.6659168312824
Log2 mRNA fold difference:-2.0496816733844
Log2 TE fold difference:0.36805564564144
Sequences
Protein sequence

MDRPAQAPTQLPPGFRFHPTDEELVVLYLRRKALARPLPAAVIPVVHDVARLDPWDVTGA
SEGEGYFFSLRRAPATGRRRRAGSGYWKATGKEKPVFLQCGGEQRQLLVGVKTALAFHRR
EPPPPSSRTGWVMHEYRLAVPRGVADQRKKNARHGCVAEPGEWVVCRVFLKNRPNRDAGS
KTLRHGASARRRRRQQQPEDVR

MERPAQAPTQLPPGFRFHPTDEELVVLYLRRKALARPLPAAVIPVVHDVAGLDPWDLPGA
SEGEGYFFSLRRAPATGRGSRRRRAGSGYWKATGKEEPVFLQCGGGGVGGKRQLLVGGKT
ALAFHRSEPSPPSSSRTGWVMHEYRLAAASRGVAEQRKKNASHGCCDAEPGEWVVCRVFL
KKGARRSRPGRDGNHSRALRHRASAAPPQLREGVGGRQPLLFPAPQSPSSSCVTGVTDLS
DEEDEVSSGSITRVCTSERGLMGILSVPSPLSHGPVAQPFSGTIQ*

Other information
Ka divergence:-0.0421413KaKs divergence:0.0851865
GC content 1 (%):71GC content 2 (%):66GC content divergence:-0.036
Length 1 (bp):606Length 2 (bp):858Length divergence:0.172
MFE 1 (kcal):-319.8MFE 2 (kcal):-417.92MFE divergence0.133