Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G054559-GRMZM2G061969
Species:maize
Duplication type:WGD
Function (paralog1):Phospholipase D alpha 1 (PLD alpha 1)(EC 3.1.4.4)(Choline phosphatase 1)(Phosphatidylcholine-hydrolyzing phospholipase D 1)
Function (paralog2):hypothetical protein LOC100280155

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:1.4563801028627
Log2 mRNA fold difference:1.4898151952946
Log2 TE fold difference:-0.02713290172364
Sequences
Protein sequence

MAQILLHGTLHATIFEAESLSNPHRATGGAPKFIRKLVEGIEDTVGVGKGATKIYATVDL
EKARVGRTRMISNEPVNPRWYESFHIYCAHMAADVIFTVKIDNSIGASLIGRAYLPVQDL
LGGEEIDKWLEICDENREPVGDSKIHVKLQYFDVGKDRNWARGVRSTKYPGVPYTFFSQR
QGCKVTLYQDAHVPDNFVPRIQLADGKNYEPHRCWEDIFDAISKAQHLIYITGWSVYTEI
TLVRDTNRPKPGGDVTLGELLKRKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETAN
YFHGTDVNCVLCPRNPDDSGSFVQDLQISTMFTHHQKIVVVDHEMPNQGSQQRRIVSFIG
GIDLCDGRYDTQYHSLFRTLDTVHHDDFHQPNFEGGSIKKGGPREPWHDIHSRLEGPIAW
DVLYNFEQRWRKQGGKDLLVRLRDLPDIIIPPSPVMFPEDRETWNVQLFRSIDGGAAFGF
PETPEEAARAGLVSGKDQIIDRSIQDAYVNAIRRAKNFIYIENQYFLGSSYGWKPEGIKP
EEIGALHLIPKELSLKIVSKIEAGERFTVYVVVPMWPEGVPESASVQAILDWQRRTMEMM
YTDIAQALEANGIEANPKDYLTFFCLGNREVKQEGEYEPEEHPEPDTDYIRAQEARRFMI
YVHTKMMIVDDEYIIIGSANINQRSMDGARDSEIAMGAYQPYHLATRQPARGQIHGFRMS
LWYEHLGMLEDVFQRPESVECVQKVNEVAEKYWDLYSSDDLEQDLPGHLLSYPIGVTADG
SVTELPGMENFPDTRARVLGNKSDYLPPILTT*

MAQILLHGTLHATIFEAESLSNPHRATGGAPKFIRKLVEGIEDTVGIGKGTTKIYATVDL
EKARVGRTRMVSNEPVNPRWYESFHIYCAHMAADVVFTVKIDNPIGASLIGRAYLPVEDI
LGGDEIDKWLEICDEKREPIGDSKIHVKLQYFDVGKDRNWARGVRSTKYPGVPYTFFSQR
QGCKVTLYQDAHVPDNFVPRIPLADGKNYEPHRCWEDIFDAISKAQHLIYITGWSVYTEI
TLVRDTSRPKPGGDVTLGELLKRKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETAN
YFHGTDVNCVLCPRNPDDSGSFVQDLQISTMFTHHQKIVVVDHELPNEGSQQRRIVSFVG
GIDLCDGRYDTQYHSLFRTLDTVHHDDFHQPNFEGGSIKKGGPREPWHDIHSRLEGPIAW
DVLYNFEQRWRKQGGKDLLVRLRDLSDIIIPPSPVMFPEDRDTWNVQLFRSIDGGAAFGF
PETPDEAARAGLVSGKDQIIDRSIQDAYINAIRRAKNFIYIENQYFLGSSYDWKPEGIKP
EDIDCLHLIPKELSLKIVSKIEAGERFTVYVVVPMWPEGVPESASVQAILDWQRRTMDMM
YTDITQALEANGIQANPKDYLTFFCLGNREVKQEGEYQPEEHPEPGTDYIRAQEARRFMI
YVHAKMMIVDDEYIIIGSANINQRSMDGARDSEIAMGAYQPYHLATRQPARGQIHGFRMS
LWYEHLGMLDDVFQRPESVECVQKVNKIAEKYWDLYSSDDLEQDLPGHLLSYPIGVTADG
TVTELPGMENFPDTRARVLGNKSDYLPPILTT*

Other information
Ka divergence:0.125806KaKs divergence:0.19573
GC content 1 (%):55GC content 2 (%):54GC content divergence:-0.009
Length 1 (bp):2439Length 2 (bp):2439Length divergence:0
MFE 1 (kcal):-949.58MFE 2 (kcal):-942.81MFE divergence-0.004