Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G054713-GRMZM2G470942
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100191186
Function (paralog2):hypothetical protein LOC100279124

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:0.3838617315195
Log2 mRNA fold difference:1.5205044571381
Log2 TE fold difference:-1.2385180413532
Sequences
Protein sequence

MEAQDDCKWRQIPAFGDWNVWDGDMPVTQYFQAGAFFFAAPAEKGDADLFKVPQLPAKPY
GYKKCVVRVKGEKETAVPPAARKGRRRRCVSEQHKWKPKGAVDEDLYKISPQLLCKVKKK
KLLRNLLGGCLGLGCIA*

MEAQDDCKWRQVPAFGDWNLWDDMPVTQYFQAGTFFFAAPTTEKDDDEDLFKVPQFPATP
YSYKKCVVRVKGEKGTAVPPAARKGGRRRRVNEQQKWKPKGAVDEDLYKISPQLLCKVKK
KKLLRNLLGGCLGLSCIA*

Other information
Ka divergence:-0.274516KaKs divergence:-0.664528
GC content 1 (%):62GC content 2 (%):60GC content divergence:-0.016
Length 1 (bp):414Length 2 (bp):417Length divergence:0.004
MFE 1 (kcal):-175.05MFE 2 (kcal):-161.7MFE divergence-0.04