Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G055089-GRMZM2G097805
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100279958
Function (paralog2):

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:0.52197545176704
Log2 mRNA fold difference:-0.31044853725406
Log2 TE fold difference:0.83018144851019
Sequences
Protein sequence

MGCVCGRPSAFDDGQCRATPPPAAKLSAAVRSKEEARKQQQLQLQQHVRAGSGREEALER
RRAMMAMAAVCQVRSPVPRAVEAEHVAVGWPPWLVAVAPEAVRGWVPRRAESFEKLDKIG
QGTYSNVYRARDLEKEKIVALKKVRFDNLEPESVKFMAREILILRRLDHPNVIKLEGLVT
SRMSCSLYLVFEYMEHDLAGLASFPGVKFTESQVKCYMQQLLRGLEHCHSRHILHRDIKG
SNLLIDNRGILKIADFGLASFFDPEQRHPLTSRVVTLWYRPPELLLGATNYGVAVDLWSA
GCILAELYAGKPIMPGRTEVEQLHKIFKLCGSPSEDYWRKSKLPHATIFKPQHPYARRVP
ETFKEFPVPALALVDVLLSVDPADRGTASSALQSEFFTTKPYACNPSSLPRYPPSKEFDA
KRREEEARRQGVTGGKQHKHDPERRTRESRAVPAPEANAELVSSLQKRQAQANTRSRSEM
FNPCKEDSASGFRIEPPRPTPVTESSEDPQRAYPTRIFHSGPLVNQSQPSKAGGGKNGEP
QVPGVANHPVVLSTRSGPRADDSGRTMVAQAEAFAHGRRLSESINEHFSNSGKYDQVFPK
KDDRNIRADGAIGYGSKGSKIHHSGPLTCPSGSNVDEMLKENDRQIQEVFRRTRVEKSRA
RRDHGHHQGGIRPGDFGAIPVFPSSRSSYQAVQQ*

MGCVCGRPSSFEDGQCRATPPPAAKLSAAVRREEEARKQQLQLQQHARAGSGREEALERR
RAMMAMAAACQVRSPVPRAVEAEQVAVGWPPWLVAVAPEAVRGWVPRRAESFEKLDKIGQ
GTYSNVYRARDLEKEKIVALKKVRFDNLEPESVKFMAREILILRRLDHPNVIKLEGLVTS
RMSCSLYLVFEYMEHDLAGLASFRGVKFTESQVKCYMQQLLRGLEHCHSRHILHRDIKGS
NLLIDNRGILKIADFGLASFFDPEQRQPLTSRVVTLWYRPPELLLGATNYGVAVDLWSAG
CILAELYAGKPIMPGRTEVEQLHKIFKLCGSPSEDYWRKSKLPHATIFKPQHPYARRVAE
TFKEFPAPTLALVDVLLSVDPADRGTASYALQSEFFTTKPYACNPSSLPRYPPSKEFDAK
RREEEARRQGVTGGKQHKHDPERRTRESRAVPAPDANAELVSSLQKRRAQANTRSRSEMF
NPCKEDSASGFRIEPPRPTPGTESSEDPQHAYPTRIFHSGPLVNQSQPSKAGGGKNDELQ
VPGVANHPVVVSSRTGPRADDSSWTMVAQAGAFSHGRRLSESINEHLSNSGKYDQVFPKK
DDRNTIRADGAIGYGSKGNKIHHSGPLTCPSGSVVDEMLKENDRQIQEVFRRTRVEKSRA
RRDHGHHQGGMRPADFGAIPVFPSSRSSYQAVQQ*

Other information
Ka divergence:0.353148KaKs divergence:0.999948
GC content 1 (%):52GC content 2 (%):52GC content divergence:0
Length 1 (bp):2085Length 2 (bp):2085Length divergence:0
MFE 1 (kcal):-765.4MFE 2 (kcal):-786.01MFE divergence0.013