Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G055125-GRMZM2G098819
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100216706
Function (paralog2):Putative uncharacterized protein

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:1.2289764391393
Log2 mRNA fold difference:0.46516314398559
Log2 TE fold difference:0.7539151877863
Sequences
Protein sequence

MSLFGLGRNQKTFRPKKSAPSGSKGAQLRKHIDATLGSGNLREAVRLPPGEDINEWLAVN
TVDFFNQVNMLYGTLTEFCTPESCPTMTAGPKYEYRWADGVQIKKPIEVSAPKYVEYLMD
WIEGQLDDESIFPQKLGTPFPPNFKEVVKTIFKRLFRVYAHTYHSHFQKIVSLKEEAHLN
TCFKHFILFTNEFGLIDKKELAPLQELIESIIVPY*

MLISVFYSFGRNQKTFRPKKSAPSGSKGAQLRKHIDATLGSGNLREAVRLPPGEDINEWL
AVNTVDFFNQVNMLYGTLTEFCTPESCPTMTAGPKYEYRWADGVQIKKPIEVSAPKYMEY
LMDWIEGQLDDESIFPQKLGTPFPPNFKEVVKTIFKRLFRVYAHIYHSHFQKIVSLKEEA
HLNTCFKHFILFTNEFGLIDKKELAPLQELIESIIVPY*

Other information
Ka divergence:0.758036KaKs divergence:0.857396
GC content 1 (%):46GC content 2 (%):45GC content divergence:-0.011
Length 1 (bp):648Length 2 (bp):657Length divergence:0.007
MFE 1 (kcal):-199.69MFE 2 (kcal):-200.9MFE divergence0.003