Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G055150-GRMZM2G151044
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):hypothetical protein LOC100381600

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:0.35883341512565
Log2 mRNA fold difference:2.5089147517697
Log2 TE fold difference:-2.4166356642087
Sequences
Protein sequence

MTNQQDVVVSEMGIAAGAALPGPSPALLACRGAAAGAMSLRYLDLAAAAARSASGTWADA
MRASSPTRSRAADEFTAWVRKHPSALGKFEQIASASKGKKVVMFLDYDGTLSPIVADPDA
AYMSDAMRAAVRDVAKHFPTSIVSGRCRDKVRNFVALSELYYAGSHGMDIKGPSSNPESV
LCQPASEFLPVMDEVYKALVEKTKSTPGAKVEHNKFCLSVHFRCVDEKRWNGLAEQVKAV
TKDYPKLKLTHGRKVLEIRPSIMWDKGKALEFLLESLGFANRSDVLPVYIGDDRTDEDAF
KVLRKRGQGIGILVSKCPKETNASYSLQDPGEVMDFLLRLVDWKRKSSAAPMVRPRV*

MTNQDVVVSEMGIAAGTALPGSSPALLACRGAAAGAMSLRYLDLAAAAARSASCTWVEAM
RASSPTRSRAAADVDELTAWMRKHPSALGKFEQIASASQGKKVVMFLDYDGTLAPIVADP
DAAYMSDVMRAAVRDVAKHFPTAIVSGRCRDKVRSFVDLSELYYAGSHGMDIEGPSSNPE
SVLCQPASEFLPVIDEVYKALVEKTKSTPGAKVENNKFCLSVHFRCVDEKRWNALAEQVK
AVIKDYPKLKLTQGRKVLEIRPSIMWDKGKALEFLLESLGFASCSDALPVYIGDDRTDED
AFKVLRKRGQGVGILVSKCPKETNASYSLQDPGEVMDFLLRLVEWKRKSTTTRPPV*

Other information
Ka divergence:0.192062KaKs divergence:0.281093
GC content 1 (%):65GC content 2 (%):65GC content divergence:0
Length 1 (bp):1074Length 2 (bp):1071Length divergence:-0.001
MFE 1 (kcal):-488.34MFE 2 (kcal):-493.4MFE divergence0.005