Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G055404-GRMZM2G151909
Species:maize
Duplication type:WGD
Function (paralog1):DNA-binding WRKY
Function (paralog2):DNA-binding WRKY

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-0.29578007102079
Log2 mRNA fold difference:0.30013697645245
Log2 TE fold difference:-0.42730967636178
Sequences
Protein sequence

MDAGAATAARERPAPPSPVPVPQASPDPSNPFPTTFVQADTTSFKQVVQILTGTPETAAA
AASGGTQASPPAPQKAAPAPPGPKKPAFKLYERRSSMRSLKMLCPLLPAAAAFAAAGGSA
GAGFSPRGFSPRGLEVLSPSMLDLPSLALGSPVTPLPPLPGSQEAAAAEDRAIAEKGFYL
HPSPRGNAGAGADLQPPPRLLPLFPVQSPSPTGRS*

MDSGAATATRERHPPPSPVLMQMSMPQASADPSNTFPTTFVQADTNSFKQVVQILTGTPE
TAEAAASSGAQAPPPAQQKPALTPPGPKKPAFKLYERRSSMRSLKMLCPLLPAFAAGDSV
EGFSPRGFSPRGIELLSPSMLDFPSLALGSPVTPLPPLPGSQEAAAAEDRAIAEKGFYLH
PSPRGNAGAGSDLQPPPRLLPLFPVQSPTARP*

Other information
Ka divergence:0.350746KaKs divergence:-0.0608053
GC content 1 (%):77GC content 2 (%):71GC content divergence:-0.041
Length 1 (bp):648Length 2 (bp):639Length divergence:-0.007
MFE 1 (kcal):-350.6MFE 2 (kcal):-291.4MFE divergence-0.092