Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G055578-GRMZM2G028190
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100382646 (LOC100382646), mRNA
Function (paralog2):hypothetical protein LOC100191432

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MADPPASDAQPEQAPAAAAASNDPAEDATVEKPLAAPPTPKLDAAAAADGSAYEVEDDEY
VSDPNDEPFPTMRRREASDDEGSEDGRPRARIGPDQDDDGQGGPEAYDDEVDEEDEEYYD
EEEEDLGEGFEEYEGRAAPPMEDGGGGGGGQVSRGEDGVAGEEGLPEGEAKGEGEEKEQE
PFAVPTSGAFYMHDDRFQEENRGRRRRMFGARKLWDAKDDQAWVHDRFEEMNLHDDRYED
QRMSRGRFRGRGGRGKARGGGRGFPRGGKQPNYHEDGNTQNRPPKVVRGRGPRRYEAVAR
SSREVVGSQRKQAARFREPVPNAAAARNSGQVSHAQQEAAPPKKNVISSSLNSASPPFYP
SGAACQD

MADPPAPDTQLEQASPAAAPADPAEDAPVEKSPAAPLTLEPDAAAVSDGAAGEVEDEEYV
SDPDDEALPTMRRREASDDEGSEDGRPTARMGPDQDDDGQGAPEAYDDEVDEEDKEYYDE
EDMGEGFEEEYEGRVALPMDDGGGSQVSRGEDGVAMEEGLTEGEAKGEGGEKEQEPFAVP
TSGAFYMHDDRFQEENRGRRRRMFGVRKLWDVKDNQAWVHDRFEEMNLHDDFYEDQRMSR
GRGGRGKARGGGRGFSRGGKQRNYHEDSNNTQNRTPKVVRGRGPRRYEAAARNNREVVGS
QRKQAARFRESAPNAVAARDSGQVSHAQPEAAPPKRNVMSSSLNSASPPFYPSSASTQDF
PVAAQTRDIQAGGSNKIPPSSMKMDDNSKLQSGSMVRGRIAMDYGGRDKLLADGPIRSSQ
GRAPTASLNSGFTSSSVNPGQSPIARASGGNSNIGISSNNQPQSHGSVMHQKLGQVQNQS
ATRIPTQQLSHRTSNLSPVAQHLPGKSGESGENGSYPTLNDSKTASAVVKVNSQETGMSS
FMYGGTQVIGAAGLSQGDQNFPGTPALLPVMQFGSQHPGGLGVPTVGMALPGYVAQQQMG
MGNNEMTWLPLLAGAAGAFGGSYPPYIALDPSFYSRSSGQTSSSVPSREPSTNRGSKYPQ
NDIGNEELDERQNKPRRYSEMNFSQ*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):61GC content 2 (%):53GC content divergence:-0.07
Length 1 (bp):1101Length 2 (bp):2058Length divergence:0.303
MFE 1 (kcal):-452.24MFE 2 (kcal):-741.9MFE divergence0.243