Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G055643-GRMZM2G028183
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100384282
Function (paralog2):hypothetical protein LOC100217233

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MIRLPTYAAFSLLATASAAYYAFSSREQFYPAMVYLSTSKICFVLLLNTGLVAMCVAWQL
ARRLFLGSLREAEVERLNEQSWREVIEILFAVTIFRQDFSVSFLAMVAALLLVKALHWLA
QKRVEYIETTPSVPLLSHIRIVSFMVFLLTVDCLFLSNSLRSLIQKQEASVAIFFSFEYM
ILATSTVSTFVKYIFYVSDMLMEGQWEKKAVYTFYLELISDLVHLSLYMLFFIAIFLNYG
VPLHLIRELYETFRNFRIRIADYVRYRKITSNMNERFPDATSEELDVSDATCIICREEMT
TAKKLLCGHLFHVHCLRSWLERQHTCPTCRAPIIPADNGHAVSARQHGAQAGVQPAAGTA
TPSSEGAPGENMSRHQAKLEAAAAAASLYGRSFVYPPANTLKRSVPPQPASSTPQSEASS
SNHQSQKDQEMQSRNSSDGLVPLPLNADGAVGSGTSTRDLENSLQKAQENFIKSQIEMLQ
IQLQMVQRGAAGPPSNENTEHTEE*

MGLEPLDRQFPCLLQAQAKQHRTAAPPLPFLFLRILLPFRRPSLFSLVATKTTDADADAL
RQVPGSVGSFAGEEHPPGDPVLFWCGFIAEVLLWDFPVAKMIRLPMYAAFSLLATASAAY
YAFSSREQFYPAMVYLSTSKICFVLLLNTGLVAMCVAWQLARRLFLGSLREAEVERLNEQ
SWREVIEILFAVTIFRQDFSVSFLAMVAALLLVKALHWLAQKRVEYIETTPSVPLLSHIR
IVSFMVFLLTVDCLFLSNSLRSLIQKREASVAIFFSFEYTILATSTLSTFVKYIFYVSDM
LMEGQWERKAVYTFYLELISDLVHLSLYMLFFIAIFLNYGVPLHLIRELYETFRSFRIRI
ADYIRYRKITSNMNERFPEATSEELDASDATCIICREEMTTAKKLLCGHLFHVHCLRSWL
ERQHTCPTCRAPIVPADNGRAASSRQHGAQAGVQPAAGTATPSSEGAPGENMSRRQAKLE
AAAAAASLYGRSFVYPPANTLNRSGSPQPTSSAPQSEASSSNHQSQKDQETQLQNSSDGL
VPLPFSADGVVGSGTSTRDLENSLQKAQENFIKSQIEMLQIQLQMVQRGAAGLSSSENTE
HTED*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):50GC content 2 (%):52GC content divergence:0.02
Length 1 (bp):1515Length 2 (bp):1815Length divergence:0.09
MFE 1 (kcal):-506.67MFE 2 (kcal):-642.12MFE divergence0.118