Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G055752-GRMZM2G400961
Species:maize
Duplication type:TD
Function (paralog1):Putative uncharacterized protein
Function (paralog2):Putative uncharacterized protein

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-2.6051473029926
Log2 mRNA fold difference:-3.5250523420078
Log2 TE fold difference:1.1040824408007
Sequences
Protein sequence

MGIHLVAFVAARGFLQVFQVSAPLLWPLNLWLPLARHLPEACAAFYDALVSHAASLRATV
RRRRRDSGDALDEYLRSAIMLTLSD*

MGFHLLAFVAARGLMQAFNLSAPLSLRLPLARHLPEALAVLYGVLAAQAAWLNGALARGA
AWSHSGSRGGVDEYVRHAMLSVYD*

Other information
Ka divergence:0.140458KaKs divergence:0.482868
GC content 1 (%):72GC content 2 (%):74GC content divergence:0.014
Length 1 (bp):258Length 2 (bp):255Length divergence:-0.006
MFE 1 (kcal):-119.2MFE 2 (kcal):-142.5MFE divergence0.089