Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G055834-GRMZM2G143998
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100191709
Function (paralog2):

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-0.11880406755659
Log2 mRNA fold difference:0.44156151260066
Log2 TE fold difference:-0.54267156165306
Sequences
Protein sequence

MEKKRLEFEVADDDHEAWVHDSSVDHRGRTPCRATTGSWKAAVFIILIEFSERLSYFGIA
TSLMIYLTKVLQEEMKVAAKNANYWVSVTTLMPLLGGFLADGYLGRFSTVVVSTAVYLLG
LTVLATAQLAPRLGPARSPRLHEALFFAGIYLVSIGTGGHKPALESFGADQFDEAHPAER
VQKMSFFNWWNCALCSGVLLGVTAIVYAQDRVGWGAATVAIAAVMAASLAVFLAGRRSYR
YRVPGGSSPLTPLLQVLVAAFWKRRLPLPADAAELYEVRPRTQSSKKRLLCHTYQLRFLD
RAAIVEPGADEGACGPWRLATVTQVEETKLVVAMVPIWVCTLPFGMEVAQVSTFFIKQAS
VMDRRLGPHFDLPPASVFALAAVAMIATVAAYDKVLVPYLRRATGGERGISILRRVGIGM
ALAVVGMGVAAAVERRRLLAASAAAGSGSGSSPSVLWLVPQFALMGVADGFAVVGLQEYF
YEQVPDGMRSLGIGLYLSVIGAGSFLSSLVITAADRASSRGGRAGWFAKDLDRSRLDLFY
WLLTCIGAVNLAFYALVATKCSYNKQTVRVGDDKFAAAGDDDVECAAA*

METTKSLEVARGAMDDDDHEEAWVHDSSVDHRGRSPARATTGSWKAAMFIILIEFSERLS
YFGIATSLMIYLTKVLQEEMKAAAKNANYWMSVTTLMPLLGGFLADGYLGRFSTVVVSTA
VYLLGLTVLATAQLAPGLGPDRSPRLHEALFFAGIYLVSAGTGGHKPALESFGADQFDEA
HAAERVRKMSFFNWWNCALCSGVLLGVTAVVYAQDRAGWGAATVALAAVMAASLAVFLAG
RRYYRYRVPEGSPLTPLLQVLVAAFRNRRLPLPDDDAELYEVRRPQSGKRRLLCHTYQLR
FLDKAAIVVEPGAGEDACGPWRLATVTQVEETKLVLAMVPIWVCTLPFGMAVAQVSTFFI
KQSSVMDRRLGPHFEPPPASVFALSAVAMIGTVAAYDKALVPYLRRATGGERGISILGRV
GIGMAFAIAGLGVAAAVERRRLLSAGAARPSTSVLWLVPQFALMGVADGFALVGLQEYFY
EQVPDGMRSLGIGLYLSVIGAGSFLSSLVITAADRASSRGGRAGWFAKDLNRSRLDLFYW
LLACISAVNLAFYALVATKCSYKQTVRAGRVGDEVECAA*

Other information
Ka divergence:-0.14084KaKs divergence:-0.290604
GC content 1 (%):69GC content 2 (%):70GC content divergence:0.007
Length 1 (bp):1767Length 2 (bp):1740Length divergence:-0.008
MFE 1 (kcal):-942.7MFE 2 (kcal):-955.7MFE divergence0.007