Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G055905-GRMZM2G518717
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100274310
Function (paralog2):Putative uncharacterized protein

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:0.2018865780367
Log2 mRNA fold difference:-1.0149078834967
Log2 TE fold difference:1.2083089277786
Sequences
Protein sequence

MDVDLWISKVKEGQHLAEHELQSLCEYVKEILIEESNVQPVNSPVTVCGDIHGQFHDLMK
LFATGGHVPETNYIFMGDFVDRGFNSLEVFTILLLLKARYPAHITLLRGNHESRQLTQVY
GFYDECQRKYGNANAWRYCTDVFDYLTLSAIINGQVLCVHGGLSPDVRTIDQIRTIDRNC
EIPHEGPFCDLMWSDPEEIETWAVSPRGAGWLFGSRVTAEFNFVNGIELVCRAHQLVQEG
LKYMFQEKGLVTVWSAPNYCYRCGNVASILSFDEKMERDVKFFTETEENNQMRGPRTAVP
YFL*

MWSDPEEIETWAVSPRGAGWLFGSRVTAEFNFVNGIELVCRAHQLVQEGLKYMFQEKGLV
TVWSAPNYCYRCGNVASILSFDEKMERDVKFFTETEENNQMRGPRTAVPYFL*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):49GC content 2 (%):48GC content divergence:-0.01
Length 1 (bp):912Length 2 (bp):339Length divergence:-0.458
MFE 1 (kcal):-317.2MFE 2 (kcal):-117.5MFE divergence-0.459