Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G055982-GRMZM2G373435
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-1.6108084123435
Log2 mRNA fold difference:-0.74630183138537
Log2 TE fold difference:-0.96862821117981
Sequences
Protein sequence

MGLRESLFGCFGAGGQEQGQEPAAAGPASRRPGGVGKRTLRRLSTANLRSLSLQDLSRKL
ETTKLHAFTLDELKAATKNFSTTNFLGEGGFGPVYKGFVDGRLRPGLQPQHVAVKYLDSD
GVQGHREWLAEVVYLGMLSHPHLVKLVGFCNQDDHRMLVYEYMPGQSLESHLFKNLLASL
PWSTRLKIAVGAAKGLAFLHEAETPVIYRDFKASNILLDSDYTAKLSDFGLAKEGPQGDA
THVTTRVMGTHGYAAPEYILTGHLTAKSDVYSFGVVLLELLTGRRSVDKSRRGREQNLVD
WARPYLRRADRLHRFMDPGLEMQYSARAAEKAAGVAHQCLQSVPKARPTMRHVVDALEPL
LALDDDVPMGPFVFTVGGAAAEAEAAPAQAGVAGDDNADAEAAGRQGKRHVMSAVHAESP
LRSRYASAVKRPESPPTLSRA*

MGLRESLLGCFGAGGGDQQEQGHEPAAARPAASRRPGGKPTLRRLSTANLRSLSLQDLSR
KLETTKLHAFTLDELRAATRNFSAANFLGEGGFGPVYKGFVDGRLRPGLQPQHVAVKYLD
SDGVQGHREWLAEVVYLGMLSHPHLVELVGFCNQDDHRMLVYEYMPRQSLENHLFKNLLA
SLPWSTRLKIAVGAAKGLAFLHEAETPVIYRDFKASNILLDSDYTAKLSDFGLAKEGPQG
DATHVTTRVMGTHGYAAPEYILTGHLTARSDVYSFGVVLLELLTGRRSVDKSRRGREQSL
VDWARPYLRRADRLHRFMDPGLEAQYSPRAAEAAAKVAHQCLQSVPKARPTMRDVVDALQ
PLLALDDDVPIGPFVFTVGGAAGAEADGVAVADDVDDQVDAEAGGRQGSKMHVMSAVHAE
SPLRSRYASAVKRPESPPTLMSRA*

Other information
Ka divergence:0.297214KaKs divergence:0.276792
GC content 1 (%):70GC content 2 (%):71GC content divergence:0.007
Length 1 (bp):1326Length 2 (bp):1335Length divergence:0.003
MFE 1 (kcal):-704MFE 2 (kcal):-710.8MFE divergence0.005