Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G055999-GRMZM2G049781
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100278376
Function (paralog2):hypothetical protein LOC100382247

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MTKDEEFKLVKIQNHALKVNIHCDGCKHKVKKLLQKIEGVYSVAIDVDNHKVSVTGDVDS
ETLIRKLTRGGKHAELWSQPKGGGNQGHKGNNGQQQKQQQPQNQNQNHQQKQKQGANLSK
DGHNKNSNGGQKDQGKQGGGGGAGGLMQGLKAFKNQHGNKHQLPELSSDDDDLYDDDDEE
EFDDDYEEELRFLGDKMSQLGFHGNNQNKNGNNAAVNSNHSNGNGKKGNGGGGANNHHQN
NNHHHHQNQKNVNVINMAAANAKMGGGGGGGVQNHQKNAAAINMAAAAAANAKMANGAQR
NAGAMGGMLGLSHGLGAAAGAAPPGFQGYAAGFNHPSSYAAAGYGGGLQQQHLQHQQQQQ
QSNNLMASMQGYHHHHPAATAAMMSNLRGLNGNVMMMHQQPQQHQQPQMMYHSSPQISPY
TGYYNPYNYYYHPHPGSAGYPPSNGDVETMFSDENTKGCVVM*

MTKDDEFKLVKIQNHVLKVNIHCDGCKHKVKKLLQKIEGVYSVAIDVDNHKVSVTGDVDS
ETLIRKLTRGGKHAELWSQHKGGSAQQKQQAQQQQQQKQGGNPSKDGHSKSSNNNGGQKK
DQGKQGGGGGVGGGLVQGLKAFKNQHGGNKQHHQLPELLSSEDDDGMFDDDDGEFDDDYE
EELRFLGDKMSQLGLHGNGNGNNQHHHQNKNGNNVVAVNSNHSNGKKGNGGAAANRHQSQ
NQKNVNVVNVAAANGKMGGGGGVQNHKNANAINMAAAANAKMGNGAQRNAGAMGGIGMLG
LSHGLGAGGAAAAAPPPGFQQGYAGFNHPPYAAAAGYGGGLQQQQQHLQHHQQQQSNSLM
ASMQGYHHHQYPAATAAVVNNLRGLNGNMVMMHQHQPQPQPQAQMMYHSSPQISSPYTGY
YNPYNYYYHHHPHPGSAGYPATASNGDVESMFSDENTKGCVVM*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):59GC content 2 (%):60GC content divergence:0.008
Length 1 (bp):1389Length 2 (bp):1392Length divergence:0.001
MFE 1 (kcal):-532.63MFE 2 (kcal):-564.62MFE divergence0.029