Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G056120-GRMZM5G874163
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100383168
Function (paralog2):Putative uncharacterized protein

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-0.81822891066236
Log2 mRNA fold difference:-1.1518300501187
Log2 TE fold difference:0.300609493596
Sequences
Protein sequence

MGIDLNMADGESQERRPPPAVCRELWHACAGPVVALPRRGSLVVYLPQGHLAAAGGGNVA
VDLPPHVACRVADVELCADAATDEVYARLALVAEGEAFGRNLRGGGVDGDDDMEDFDVER
KSRMLHMFCKTLTASDTSTHGGFSVPRRAAEDCFPPLDYNQLRPSQELVAKDLHGAKWKF
RHIYRGQPRRHLLTTGWSSFVNKKKLVSGDAVLFLRGDDGELRLGVRRAIQLKNEALFDD
FSCDSTKRHTLLAVADSLKHKSVFHISYNPRATASEYIIPHHKFLKSLNLPFCIGARINL
QCHNEDVSERRSGMVVHVSEIDPMKWPGSKWRSLLVRWEDGVECNGQDRVSPWEIEIAGG
SVSVAHSVSASSSKRTKLCPQGNLDVPTMYVTGNGNGCTDSVETGKFPRVLQGQDLMSFR
TRHVPSAPQTVEAAKLQSSGASRFLSNARGCALGGPTSRLAVHNSDFTYQSVGFNESIGF
SEVLQGQEISRAVPMFQGMMSEACSLKGGYGLHSYMRTPVAVTGLSATTQECSLTLSTPP
GAQVPSVYPDNIFNRTVVRQLGLASKFDGGATNAQQSVPFDRPREIWSKPQHEISDQTKM
DHFETRRASAPGDDAAKHGSGGEVVRKTSCRLFGFSLTEKILPADDDGIKEVTYEPECQN
PRMLDLFGYNCSAPSAALPALCAAPFGM*

MGIDLNMVDGEGHERRPPPVTCRELWHACAGPVVALPRRGSLVVYLPQGHLAAAGGGDVA
ADLPPHVVCRVADVELCADAATDEVCARLALVAEGEAFGRNLGGGGVEGDDGMEDFDAER
KSGMLHMFCKTLTASDTSTHGGFSVPRRAAEDCFPPLDYNQLRPSQELVAKDLHGAKWKF
RHIYRGQPRRHLLTTGWSSFVNKKKLVSGDAVLFLRGDDGELRLGVRRAIQLKNEALFED
FNSDSTKRHSLTAVADSLKNRSVFHISYNPRATASEYIIPYAKFLKSLNHPVCIGARINF
QCHNEDVSERRSGVVVRISEIDPMKWPGSKWRSLLVRWEDGAECNGQDRVSPWEIEIAGG
SVSVSHSLSASSSKRTKLCPQGNLDVPAMWNGCTDSMETGKLPRVLQGQELMSFRTCHVP
CAPQTAEAAKLQSSDASRFLSNAHGCALGGPTSRLAVHSSGFTYQCVGFNESIGFSEVLQ
GQEISRAVPKFQGMMSEACSLKDRYGLHSYMRAPVAVNGLSATTQECSLALSTPPGAQVP
SLYPGNVVNRTVVPQLGLARKFGGGGTNGQQSGPFDRPRELWTRPQHETPDQMNLDQFET
RRPSVPVDAAKLGSGGGEVRKTSCRLFGFSLTEKILPADDDDVKEVSYETECQNPRMLDL
FGYNCSTPSAALPALCAAAPFGM*

Other information
Ka divergence:-0.181548KaKs divergence:0.0525313
GC content 1 (%):50GC content 2 (%):51GC content divergence:0.01
Length 1 (bp):2067Length 2 (bp):2052Length divergence:-0.004
MFE 1 (kcal):-769.97MFE 2 (kcal):-774.23MFE divergence0.003