Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G056252-GRMZM2G064701
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100191328
Function (paralog2):omega-6 fatty acid desaturase, endoplasmic reticulum isozyme 2

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MGAGGRMTEKEREKQEQLARATGGAAMQRSPVEKPPFTLGQIKKAIPPHCFERSVLKSFS
YVVHDLVIAAALLYFALAIIPALPSPLRYAAWPLYWIAQGCVCTGVWVIAHECGHHAFSD
YSLLDDVVGLVLHSSLMVPYFSWKYSHRRHHSNTGSLERDEVFVPKKKEALPWYTPYVYN
NPGRPGGAHRGAAHPRVAAVPGDQRVGAAVPALRLPLRPLRPHLQRPGARPDLRLGRRRR
GRGVRAVQAGGGVRGLVGGARVRRAAADRERVAGAHHLPAAHPPVAPPLRLERVGLAARR
AGHHGPRLRHPQPRVPQHHGHARRAPPLLHHAALPRHGGHQGDQAHPRGLLPLRPDPCCQ
GDLARGQGVHLRRARGPQGRLLVQQEVLAAAARRAERTLP*

MKLYSLQPYFSGSQILKKILTKKLNQTREPRARVRRCTSCVTPPGLPGSSQIGLYMCTGP
DFTSADVVTASHDHIWLLRAQAPVTPCPPLNSASLPGCRRNRGGQAPSSFLLPANPAGTT
ARFPVRGTGEKGRDRERVRRGVRPICSAPRSSLSRRPHSQQPAKMGAGGRMTEKEREKHE
QEQVARATGGGAAVQRSPVEKPPFTLGQIKKAIPPHCFERSVLRSFSYVAHDLSLAAALL
YLAVAVIPALPCPLRYAAWPLYWVAQGCVCTGVWVIAHECGHHAFSDHALLDDAVGLALH
SALLVPYFSWKYSHRRHHSNTGSLERDEVFVPRTKEALPWYAPYVHGSPAGRLAHVAVQL
TLGWPLYLATNASGRPYPRFACHFDPYGPIYGDRERAQIFVSDAGVAAVAFGLYKLAAAF
GLWWVVRVYAVPLLIVNAWLVLITYLQHTHPALPHYDSGEWDWLRGALATVDRDYGVLNR
VFHHITDTHVAHHLFSTMPHYHAVEATRAIRPVLGEYYQFDPTPVAKATWREARECIYVE
PENRNRKGVFWYNSKF*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):67GC content 2 (%):67GC content divergence:0
Length 1 (bp):1203Length 2 (bp):1671Length divergence:0.163
MFE 1 (kcal):-565.17MFE 2 (kcal):-800.5MFE divergence0.172