Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G056373-GRMZM2G121456
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):hypothetical protein LOC100194286

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:0.032754335304293
Log2 mRNA fold difference:2.092508453017
Log2 TE fold difference:-2.0699453221437
Sequences
Protein sequence

MAIATTTSSSSLTIRLLHPNPNTNPAPRSLQLLSSRRCARAAVAGGAVPYGAAPRRGIWS
IRDDLVVPRSPYFPVDSAAGQERGPSPMVMERFQSVVSQLFQHRIIRCGGPVEDDMANII
VAQLLYLDAIDPTKPLDKINVDTDRDYFMSAKEAKEYGLIDGVIMNPLKALQPLPASS*

MATTTSSSSLTTPLLRPNPNTNPAPRSLQLLRSRRCARAVTTAVAGGAVPYGANPRRGIW
SIRDDLVVPRSPYFPVESAAGQERGPSPMVMERFQSVVSQLFQHRIIRCGGPVEDDMANI
IVAQLLYLDAIDPNKDIIMYVNSPGGSVTAGMAIFDTMKHIRPDVSTVCIGLAASMGAFL
LSAGTKGKRYSLPNSRIMIHQPLGGAQGQETDLEIQANEMLHHKANLNGYLAYHTGQPLD
KINVDTDRDYFMSAKEAKEYGLIDGVIMNPLKALQPLPASS*

Other information
Ka divergence:-0.225769KaKs divergence:-0.00700848
GC content 1 (%):57GC content 2 (%):53GC content divergence:-0.036
Length 1 (bp):537Length 2 (bp):846Length divergence:0.223
MFE 1 (kcal):-188.92MFE 2 (kcal):-296.32MFE divergence0.221