Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G056407-GRMZM2G139284
Species:maize
Duplication type:WGD
Function (paralog1):MYB94
Function (paralog2):MYB94

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MRCSKSCRLRWTNYLRPGIKRGNFTEQEEKLIVHLQALLGNRYVRRARIYWAHGVTAGDR
SSYLVWDGMGCDGRCGCVAHGFAWCGVGGRPSRRTCRSGRTTTSRTTGTRTSSASCRAAA
TGRPSRRRTGRRRRPRASGRGGCRRTSTWRAARFARPSPRSTTSSRSCSATPPPTRRPLA
RARAAVTARLRARRARRSPPLWRQRPSPPPPRGRTFSPRRTSRGCWTGGLAGRSAAAGPR
APPAVPRARPRDPRTRRRCRTVAPPSHRPRRRPLVVGRSSNTRRSRACRRPISRCRCRRS
SRGCSTTTATCTMLSRAPACSMPPPWITPSSSSVSNRSSSS*

MARPPCCDKEGVKKGPWTPEEDLVLVSYIQDHGPGNWRAVPTRTGLMRCSKSCRLRWTNY
LRPGIRRGNFTEQEEKLIVHLQALLGNRWAAIASYLPERTDNDVKNYWNTHLKRKLQAGS
GDGDGDGAAKPPAHRPPPSNSKGQWERRLQTDINLARRALREALTPLGDLKPQPQRDGGG
DSPASTSSSQCSPPPAPAAAGPYVLTADTVSRMLDGWAGLNGKRRGGAPGTPGGAETAST
GSSSEVSYGGGTAVVAPAAGGPVFEYETKPPAAPFQLMMPLSAIESWLFDDDTHFHRPVQ
SASLLDAAPMDYYLL*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):69GC content 2 (%):71GC content divergence:0.014
Length 1 (bp):1026Length 2 (bp):948Length divergence:-0.04
MFE 1 (kcal):-531MFE 2 (kcal):-497.5MFE divergence-0.033