Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G056424-GRMZM2G005984
Species:maize
Duplication type:WGD
Function (paralog1):photosystem II 11 kD protein
Function (paralog2):photosystem II 11 kD protein

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MRATSSPVAGAVLAAPSSAAAVVVKPLPRGAANGGSTGRREVLAGTGLGAALLLALGPVC
GAARAADEEYVSETKEVIGKVRSTINLDKSDPSVADAVAELRELSNSWVAKYRREKSLLG
RPSFREMYSALNAVSGHYISFGPTAPIPAKRRARILEEMDTAEKALLRGR*

MRATSSPVPAAVLVAPSSAAVAVKPRAAASGGGGSTAGRRDVLAAGTGLGAALLLALGPA
RAADEEYVSETKEVIGKVRSTIGLDKSDPSVADAVAELRDLSNSWVAKYRREKSLLGRPS
FREMYSALNAVSGHYISFGPTAPIPAKRRARILEEMDTAEKALQRGR*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):71GC content 2 (%):72GC content divergence:0.007
Length 1 (bp):513Length 2 (bp):504Length divergence:-0.009
MFE 1 (kcal):-256.4MFE 2 (kcal):-263.64MFE divergence0.014