Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G056505-GRMZM2G106752
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-0.13282081278889
Log2 mRNA fold difference:0.019559781894571
Log2 TE fold difference:-0.16629839346496
Sequences
Protein sequence

MSTGSAGVFLHRGNQALMDDSAVPIGFSMTSYTTGNQFQSRITFGIDQLGSAVNNSSSHG
RRGFQRWIHAPAQDDGCRLVLGLGPTPDPDVNSPDQQPAGAGADKSRPPPVTLFGQSFSF
ADPGTLSLGIHQGRSTGANKHLGAGTIISFSTVDEGSTSARSSSGGYMPSLLFARRPNCS
TAEEEQGLLDDTDTDNSNDGTEPSASMTEASFGGVSSDAVTLVSNSGQQAQRRHPKKCRF
KGCSKGARGATGLCIAHGGGQRCQKPGCHKGAESRTAYCKAHGGGRRCLQLGCTKSAEGK
TDHCIAHGGGQRCGYPDCPKAARGKSGRCIKHGGGKRCSVEGCIRSAEGRVGLCISHGGG
RRCQFPDCRRGAQGSTLYCKSHGGGKRCVFEGCGKGAEGSTPLCKAHGGGKRCVYEGGGV
CPKSVHGGTDFCVAHGGGKRCAVPGCSKSARGRTDRCVKHGGGKRCRVDGCGKSAQGSTD
CCKAHGGGKRCNFGDGQCEKFARGRSGLCAAHDTLVASQQRRGGGMIGPGLFHGIVRSAS
VANMNSDYSSSGVSTVSDCDGSPEAATRRQELIPPQVLVPRSMKSLTAATVQPPKRSREG
RVVTVPEGRVHGGGLLSLLGGSFMNVDKL*

MNTMDDSAVSIGFSVTNYTTGSHGQSQVTLGIDQLGSAVNNSSGHGRRGFQRSIHAPAQD
DGCRLVLGLGPTPAPDVNSCDCDQQPAGADKSRPPVTLFGQSFSFADPGALSLGIHRGRD
NAGATKHLGVPVPAGTVISFSTVDEGSTSARRSSGGYMPLLLLAPLPNYSTAEEEQGLLD
DTDNSNNGGTDPRGFRFSPEPSASMTEASFGGASSDVVTVASNPGQQTQRRHPKKCRFKG
CSKGARGASGLCIAHGGGQRCQKPGCYKGAESRTAYCKAHGGGRRCLQLGCTKSAEGKTD
HCIAHGGGRRCGYLDCPKAARGKSGRCIKHGGGKRCSVEGCIRSAEGRVGLCISHGGGRR
CQFPDCRKGAQGSTLYCKSHGGGKRCVFEGCGKGAEGSTPLCKAHGGGKRCMYEGGGVCP
KSVHGGTDFCVAHGGGKRCAVPECSKSARGRTDCCVKHGGGKRCRVDGCGKSAQGSTEYC
KAHGGGKRCNFGGVCEKFARGRSGLCAAHGTLVASRQRRSGGGGMIGPGLFRGIVRSASA
ANMYSEYSSSGVSTVSDCDGSPEAATGRHELIPPQVLVPHSMKSLTAAAVQPPARSREGG
VVAVPEGRVHGGGLLSLLGGSFRNVDVDKL*

Other information
Ka divergence:-0.169597KaKs divergence:-0.0927152
GC content 1 (%):64GC content 2 (%):64GC content divergence:0
Length 1 (bp):1890Length 2 (bp):1893Length divergence:0.001
MFE 1 (kcal):-892.3MFE 2 (kcal):-895.5MFE divergence0.002