Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G056547-GRMZM2G065040
Species:maize
Duplication type:TD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-0.27500435584251
Log2 mRNA fold difference:1.2984465796462
Log2 TE fold difference:-1.4831985237541
Sequences
Protein sequence

MAGEVELALEDADVAMRVAADDDSITAMVVSVLLTLAFVGLSILTLGVIYLSVEDFLHKR
EKEKFEKEEAEKQKEEARKKRAKSRQKRRNY*

MADEAELALEDADAAMRVAADDDSITATVVSVLLTLAFVGLSILTLGVIYLSVQDFLQKR
EKEKFEKEEAKKQKEEARKKRAKSRQKRRNY*

Other information
Ka divergence:-0.433903KaKs divergence:-0.999581
GC content 1 (%):56GC content 2 (%):56GC content divergence:0
Length 1 (bp):276Length 2 (bp):276Length divergence:0
MFE 1 (kcal):-101.71MFE 2 (kcal):-96.7MFE divergence-0.025